KEGG   Sus scrofa (pig): 100511657Help
Entry
100511657         CDS       T01009                                 

Gene name
NLK
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100511657 (NLK)
   04310 Wnt signaling pathway
    100511657 (NLK)
   04068 FoxO signaling pathway
    100511657 (NLK)
 Cellular Processes
  Cellular community
   04520 Adherens junction
    100511657 (NLK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100511657 (NLK)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100511657 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 226 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEMLKNRHLCFHSN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcggcagcagcagggcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcaccttcaccaccaccaccaccctcagcaccatcttcatcccgggtcggctgctgct
gtccaccccgtacagcagcatacctcgtcggcagctgcggcagccgcagcagcggccgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggt
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgccaca
gttaaggcgcaccatcatcagcactcgcatcatccacaacagcagctggatattgagccg
gatagacctattggatatggagcctttggtgtcgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagagatgttaaaaaatcgacac
ctgtgctttcacagtaattag

DBGET integrated database retrieval system