KEGG   Sus scrofa (pig): 100511747Help
Entry
100511747         CDS       T01009                                 

Gene name
SETD1A
Definition
SET domain containing 1A
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ssc00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1541 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGIHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAFPAGTAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAIPATTAATAAASSSSSSLSSSSSSSSSSSSSHFR
GSDSNYPAYYESWNRYQRHASYPPRRATREEPSGAPFAENAAERFPPSYTSYLPPEPSRP
ADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNESV
PFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSATGPGARDAGSELPSGSGHGPCT
PPPAPANFEDVAPTGSGDPGAPRESPKANGQSQASPCSSGEDMEISDDDRGGSPPPAPTL
SGEEARLPPREEAELAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFD
QWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGL
RGALRLPSFKVKRKEPSEISEASEEKRPRPSTPPEEDEDDAEREKEVGEPGRPGTKPPKR
DEERSKTQGKHRKSFALDSEGEEASQESSSEKDEEDEEEDEEDEEREEAMDAAKKETGAS
DGEDEESDSSSKCSLYADSDGENDSTSDSESSSSSSSTSSSSSSSSSSSSSSSSESSSEE
EEEEEEQPATIPSAPSPPRDVPAPLPAPAEEPEPERVADSPVTALPEQETSPARPAGSAE
ELPPSVPQPPPEPPAGPPAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAVEEVPAPEPPP
AAPPQVKSPVPTSRKVPRGVERTIRNLPLDHASLVKSWPEEVSRGGRNRAAGRGRSTEEE
EAEPGTEVDLAVLADLALTPARRGLPTLPAGDDSEATETLDEADRPGPLLSHILLEHNYA
LAVKPPPSTPAPRPLEPVPAPAALFSSPADEVLEAPEVVVAEAEEPKQQQQQQEEGEEEE
EEEEESESSESSSSSSSDGEGAIRRRSLRSHTRRRRPPPPPPPPPPPTYEPRSEFEQMTI
LYDIWNSGLDLEDMGYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGP
REHQTGSARSEGYYPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSA
IGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMV
ADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKI
VIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 4626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaggccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccttgcgcaggccttctcaaaaggtgtac
cgctatgatggaattcacttcagtgtcaacgactcaaagtatataccagttgaagacctc
caagacccccgctgccacgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggacgagttctacatcggacagatcccactgaaagaagtgactttcgcgagg
ctgaatgacaacgtgcgggagaccttcctgaaggacatgtgccgaaagtatggcgaggtg
gaagaggtcgagatccttcttcaccctcgtactcgcaagcacctgggcctggcccgtgtg
ctcttcaccagcactcggggagccaaggaaacagtcaaaaacctccaccttacctccgtc
atgggcaacatcatccacgcccagctcgacatcaaaggacagcaacgaatgaagtattat
gagctgatagtcaatggctcctacacccctcagacggtgcccactgggggcaaggctctg
agtgagaagttccaaggctctggtgcagccactgagacgactgaatcccgccgccgatcc
tcctccgacacagctgccttcccagcaggcactgctgtggtgggcactcctggcaatggc
accccctgttcccaggacacaagcttctccagcagccgacaagacaccccatcttccttc
ggccagttcacccctcagtcctcccaaggaaccccctacacgtctcggggcagcaccccc
tactctcaggactccgcctactccagcagcaccacttccacctccttcaagccccggcgg
tcagagaacagctaccaagattcgttctcccgccgccatttctctgcatcttcggccccc
acgaccacctctgcagccatccccgccaccacggcagccaccgccgccgcctcctcttct
tcctcctcgttgtcctcatcctcttcgtcgtcctcgtcttcctcatcctctcattttcgt
ggttcagactcaaactacccagcatattatgaaagctggaatcgctaccaacgccatgct
tcctacccaccccgccgggcaactcgggaggagccctcaggggcaccttttgctgaaaat
gcagctgagcgcttcccaccttcctacacctcctacttgcccccggagcccagccgccct
gctgaccaggactaccggcctcctgcctcggaagctccacccccagagcctccagaacct
ggtggaggtggcgggggcggggggcccagccccgagagagaagaagctcggacctccccc
cggccagcctcacccgcccgctctggctccccagccccagagaccaccaatgagagcgtg
cccttcgctcagcacagcagcctggattctcgcattgagatgttgctgaaggagcagcgc
tccaagttttctttcctggcctccgacactgaggaagaggaagaaaacagcgccacaggc
cctggtgccagagatgcggggagcgagctgccttctgggtcaggtcacggcccctgcacg
ccccctccagccccagcaaattttgaggatgtggcacccacagggagtggggacccagga
gctccccgggagtcacccaaggccaacggacagagccaggcttctccatgctcttctgga
gaggacatggaaatctccgacgatgaccggggcggctcaccccctccggcccccacactc
tcgggagaagaggcccggctgcctcccagggaggaagcagagctggcagagggcaaggcc
ctaccatcggcaggcactgtgggccgcgtgctggccaccttagtccaagagatgaagagc
atcatgcagcgagacctcaaccgcaagatggtggagaatgtggcctttggagcctttgac
cagtggtgggaaagcaaggaagaaaaggccaagccattccagaacgcagctaaacagcaa
gccaaggaggaggataaagagaagacaaagctcaaagagccaggcctgctgtccctcgta
gactgggccaagagcgggggtaccaccggcattgaagcttttgcctttgggtcagggctg
cgaggggccctgcggctgccttctttcaaggtaaagcgaaaagagccttcagaaatttca
gaggccagtgaggaaaagaggccccggccttctactccccctgaagaagatgaagatgat
gctgagcgagagaaggaggttggagagccagggcgtccggggaccaagcccccgaagcga
gatgaagagcgcagcaagacccagggcaagcaccgcaagtcctttgctctggacagcgag
ggagaggaggcgtcacaggagtcctcctcggagaaggatgaggaggatgaagaggaagat
gaggaagatgaagagcgtgaggaagccatggatgctgccaagaaggagacaggggcatca
gatggcgaggacgaggaaagcgattcgtcctccaaatgttctctgtatgctgactcagat
ggcgagaatgatagcacgtcggactccgagagcagcagctcatccagctccacatcttcc
tcctcttcctcctcctcgtcgtcatcgtcctcctcctcatctgagtcctcctctgaagag
gaagaagaggaagaggagcagcccgcaaccataccctcagcgccatcgccccctagagat
gtccctgcgcccctgccagcacctgccgaggagcctgagccggaaagggttgcggactcc
cccgtcacagctctccccgaacaggagacgtctccggcaagaccggcgggatccgctgag
gagctccctcccagcgtgccccagcctcccccggagccaccagctgggcccccggcccct
gccccccgccccgatgagcgcccctcctctcctatccccctcttgcctccacccaagaaa
cgccggaaaaccgtctccttctctgccgtggaggaggtgccagccccagagcctcccccg
gctgccccgccgcaggtcaagtctcccgttcccacctcccgcaaggtcccccggggcgta
gagcggaccattcgcaacctgcccctggaccacgcatctctggtcaagagctggccggaa
gaggtgtcccgaggaggcaggaaccgggccgcaggccgaggccgctccaccgaagaagaa
gaggctgagccagggacggaagtggacctggcggtgctggccgacctggccttgacccca
gcccggcgtgggctgcccaccctgccagccggcgacgactcagaggccacagagacattg
gacgaggcggaccgcccgggccccctgctcagccacatcctcctggagcacaactacgcc
ctggcggtcaagccgccgccctccacgccggcccctcggcctctggagccagttcctgcc
cccgcagccctcttcagctccccggcagacgaggtcctggaggcccctgaggtggtggtg
gctgaggcggaggagccaaagcaacagcagcagcagcaggaagagggggaggaggaggag
gaggaagaggaggagtcggagtcatcggagagcagcagcagcagcagcagtgacggcgag
ggggccatccggcggcgcagcctccgctcccacacgagacgccggcggccgcccccgccc
cccccacccccgccccctcccacctacgagccgcgcagcgagtttgagcagatgaccatc
ctgtatgacatttggaactcgggcctggacttggaggacatgggctacctgcggctgaca
tacgagcggctgctgcagcagacgagtggggctgactggcttaacgacacccactgggtc
catcacaccatcaccaacctgagcactccaaaacgcaagcggcggcctcaggatgggccc
cgcgagcaccagacgggctcggctcgaagcgaaggctattaccccatcagcaagaaggag
aaggacaggtacctggatgtgtgccccgtctcggcccggcagctggaaggagccgacact
caggggacgaaccgtgtgctttcggagcgccggtcggagcagcggcggctgctgagcgcc
atcggcacgtcggccatcatggacagcgacctgctgaagttaaaccagctcaagttccgg
aagaagaagctgcgatttggccggagccggatccacgagtgggggctgtttgccatggaa
cccatcgcagccgacgagatggtcatcgaatatgtgggtcagaacatccgccagatggtg
gccgacatgcgggagaagcgctacgtgcaggagggcattggcagcagctacctgttccgg
gtggatcatgacaccatcatcgatgccacgaagtgtggcaacctggcgaggttcatcaac
cactgctgcacgcccaactgctatgccaaggtgatcaccatcgagtcgcagaagaagatc
gtgatctactccaagcagcccatcggtgtggacgaggagatcacctacgactacaagttc
ccgctggaggacaacaagatcccgtgtctgtgcggcaccgagagctgccgcggctccctc
aactga

DBGET integrated database retrieval system