KEGG   Sus scrofa (pig): 100511747Help
Entry
100511747         CDS       T01009                                 

Gene name
SETD1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100511747 (SETD1A)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100511747 (SETD1A)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100511747 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     100511747 (SETD1A)
    COMPASS/SET1 complex (yeast)
     100511747 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1540 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGIHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAFPAGTAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAIPATTAATAAASSSSSSLSSSSSSSSSSSSSHFR
GSDSNYPAYYESWNRYQRHASYPPRRATREEPSGAPFAENAAERFPPSYTSYLPPEPSRP
ADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNESV
PFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSATGPGARDAGSELPSGSGHGPCT
PPPAPANFEDVAPTGSGDPGAPRESPKANGQSQASPCSSGEDMEISDDDRGGSPPPAPIS
GEEARLPPREEAELAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQ
WWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLR
GALRLPSFKVKRKEPSEISEASEEKRPRPSTPPEEDEDDAEREKEVGEPGRPGTKPPKRD
EERSKTQGKHRKSFALDSEGEEASQESSSEKDEEDEEEDEEDEEREEAMDAAKKETGASD
GEDEESDSSSKCSLYADSDGENDSTSDSESSSSSSSTSSSSSSSSSSSSSSSSESSSEEE
EEEEEQPATIPSAPSPPRDVPAPLPAPAEEPEPERVADSPVTALPEQETSPARPAGSAEE
LPPSVPQPPPEPPAGPPAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAVEEVPAPEPPPA
APPQVKSPVPTSRKVPRGVERTIRNLPLDHASLVKSWPEEVSRGGRNRAAGRGRSTEEEE
AEPGTEVDLAVLADLALTPARRGLPTLPAGDDSEATETLDEADRPGPLLSHILLEHNYAL
AVKPPPSTPAPRPLEPVPAPAALFSSPADEVLEAPEVVVAEAEEPKQQQQQQEEGEEEEE
EEEESESSESSSSSSSDGEGAIRRRSLRSHTRRRRPPPPPPPPPPPTYEPRSEFEQMTIL
YDIWNSGLDLEDMGYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPR
EHQTGSARSEGYYPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSAI
GTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVA
DMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIV
IYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 4623 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaggccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccttgcgcaggccttctcaaaaggtgtac
cgctatgatggaattcacttcagtgtcaacgactcaaagtatataccagttgaagacctc
caagacccccgctgccacgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggacgagttctacatcggacagatcccactgaaagaagtgactttcgcgagg
ctgaatgacaacgtgcgggagaccttcctgaaggacatgtgccgaaagtatggcgaggtg
gaagaggtcgagatccttcttcaccctcgtactcgcaagcacctgggcctggcccgtgtg
ctcttcaccagcactcggggagccaaggaaacagtcaaaaacctccaccttacctccgtc
atgggcaacatcatccacgcccagctcgacatcaaaggacagcaacgaatgaagtattat
gagctgatagtcaatggctcctacacccctcagacggtgcccactgggggcaaggctctg
agtgagaagttccaaggctctggtgcagccactgagacgactgaatcccgccgccgatcc
tcctccgacacagctgccttcccagcaggcactgctgtggtgggcactcctggcaatggc
accccctgttcccaggacacaagcttctccagcagccgacaagacaccccatcttccttc
ggccagttcacccctcagtcctcccaaggaaccccctacacgtctcggggcagcaccccc
tactctcaggactccgcctactccagcagcaccacttccacctccttcaagccccggcgg
tcagagaacagctaccaagattcgttctcccgccgccatttctctgcatcttcggccccc
acgaccacctctgcagccatccccgccaccacggcagccaccgccgccgcctcctcttct
tcctcctcgttgtcctcatcctcttcgtcgtcctcgtcttcctcatcctctcattttcgt
ggttcagactcaaactacccagcatattatgaaagctggaatcgctaccaacgccatgct
tcctacccaccccgccgggcaactcgggaggagccctcaggggcaccttttgctgaaaat
gcagctgagcgcttcccaccttcctacacctcctacttgcccccggagcccagccgccct
gctgaccaggactaccggcctcctgcctcggaagctccacccccagagcctccagaacct
ggtggaggtggcgggggcggggggcccagccccgagagagaagaagctcggacctccccc
cggccagcctcacccgcccgctctggctccccagccccagagaccaccaatgagagcgtg
cccttcgctcagcacagcagcctggattctcgcattgagatgttgctgaaggagcagcgc
tccaagttttctttcctggcctccgacactgaggaagaggaagaaaacagcgccacaggc
cctggtgccagagatgcggggagcgagctgccttctgggtcaggtcacggcccctgcacg
ccccctccagccccagcaaattttgaggatgtggcacccacagggagtggggacccagga
gctccccgggagtcacccaaggccaacggacagagccaggcttctccatgctcttctgga
gaggacatggaaatctccgacgatgaccggggcggctcaccccctccggcccccatctcg
ggagaagaggcccggctgcctcccagggaggaagcagagctggcagagggcaaggcccta
ccatcggcaggcactgtgggccgcgtgctggccaccttagtccaagagatgaagagcatc
atgcagcgagacctcaaccgcaagatggtggagaatgtggcctttggagcctttgaccag
tggtgggaaagcaaggaagaaaaggccaagccattccagaacgcagctaaacagcaagcc
aaggaggaggataaagagaagacaaagctcaaagagccaggcctgctgtccctcgtagac
tgggccaagagcgggggtaccaccggcattgaagcttttgcctttgggtcagggctgcga
ggggccctgcggctgccttctttcaaggtaaagcgaaaagagccttcagaaatttcagag
gccagtgaggaaaagaggccccggccttctactccccctgaagaagatgaagatgatgct
gagcgagagaaggaggttggagagccagggcgtccggggaccaagcccccgaagcgagat
gaagagcgcagcaagacccagggcaagcaccgcaagtcctttgctctggacagcgaggga
gaggaggcgtcacaggagtcctcctcggagaaggatgaggaggatgaagaggaagatgag
gaagatgaagagcgtgaggaagccatggatgctgccaagaaggagacaggggcatcagat
ggcgaggacgaggaaagcgattcgtcctccaaatgttctctgtatgctgactcagatggc
gagaatgatagcacgtcggactccgagagcagcagctcatccagctccacatcttcctcc
tcttcctcctcctcgtcgtcatcgtcctcctcctcatctgagtcctcctctgaagaggaa
gaagaggaagaggagcagcccgcaaccataccctcagcgccatcgccccctagagatgtc
cctgcgcccctgccagcacctgccgaggagcctgagccggaaagggttgcggactccccc
gtcacagctctccccgaacaggagacgtctccggcaagaccggcgggatccgctgaggag
ctccctcccagcgtgccccagcctcccccggagccaccagctgggcccccggcccctgcc
ccccgccccgatgagcgcccctcctctcctatccccctcttgcctccacccaagaaacgc
cggaaaaccgtctccttctctgccgtggaggaggtgccagccccagagcctcccccggct
gccccgccgcaggtcaagtctcccgttcccacctcccgcaaggtcccccggggcgtagag
cggaccattcgcaacctgcccctggaccacgcatctctggtcaagagctggccggaagag
gtgtcccgaggaggcaggaaccgggccgcaggccgaggccgctccaccgaagaagaagag
gctgagccagggacggaagtggacctggcggtgctggccgacctggccttgaccccagcc
cggcgtgggctgcccaccctgccagccggcgacgactcagaggccacagagacattggac
gaggcggaccgcccgggccccctgctcagccacatcctcctggagcacaactacgccctg
gcggtcaagccgccgccctccacgccggcccctcggcctctggagccagttcctgccccc
gcagccctcttcagctccccggcagacgaggtcctggaggcccctgaggtggtggtggct
gaggcggaggagccaaagcaacagcagcagcagcaggaagagggggaggaggaggaggag
gaagaggaggagtcggagtcatcggagagcagcagcagcagcagcagtgacggcgagggg
gccatccggcggcgcagcctccgctcccacacgagacgccggcggccgcccccgcccccc
ccacccccgccccctcccacctacgagccgcgcagcgagtttgagcagatgaccatcctg
tatgacatttggaactcgggcctggacttggaggacatgggctacctgcggctgacatac
gagcggctgctgcagcagacgagtggggctgactggcttaacgacacccactgggtccat
cacaccatcaccaacctgagcactccaaaacgcaagcggcggcctcaggatgggccccgc
gagcaccagacgggctcggctcgaagcgaaggctattaccccatcagcaagaaggagaag
gacaggtacctggatgtgtgccccgtctcggcccggcagctggaaggagccgacactcag
gggacgaaccgtgtgctttcggagcgccggtcggagcagcggcggctgctgagcgccatc
ggcacgtcggccatcatggacagcgacctgctgaagttaaaccagctcaagttccggaag
aagaagctgcgatttggccggagccggatccacgagtgggggctgtttgccatggaaccc
atcgcagccgacgagatggtcatcgaatatgtgggtcagaacatccgccagatggtggcc
gacatgcgggagaagcgctacgtgcaggagggcattggcagcagctacctgttccgggtg
gatcatgacaccatcatcgatgccacgaagtgtggcaacctggcgaggttcatcaaccac
tgctgcacgcccaactgctatgccaaggtgatcaccatcgagtcgcagaagaagatcgtg
atctactccaagcagcccatcggtgtggacgaggagatcacctacgactacaagttcccg
ctggaggacaacaagatcccgtgtctgtgcggcaccgagagctgccgcggctccctcaac
tga

DBGET integrated database retrieval system