KEGG   Sus scrofa (pig): 100511837Help
Entry
100511837         CDS       T01009                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100511837 (PAK2)
   04010 MAPK signaling pathway
    100511837 (PAK2)
   04012 ErbB signaling pathway
    100511837 (PAK2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100511837 (PAK2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100511837 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100511837 (PAK2)
  Development
   04360 Axon guidance
    100511837 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100511837 (PAK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100511837 (PAK2)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100511837 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALHTKGSETSAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDGGAKTSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLTPIFRDFLNRC
LEMDVEKRGSARELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcaccccctgtgcgaatgagcagt
accatttttagtactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaagcaca
gagaaaggaagtaagaagaaagagaaggaaaggccagaaatttctcctccgtctgatttt
gagcacaccatccatgttggttttgatgctgtcactggagaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcttaaagttctacgactccaacacagtgaagcagaaatacctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcactgcataccaag
ggatcggaaacgtcagcagtagtaacagaggaagacgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacaaaatcaatttatacacggtctgtaattgat
cctattcctgctccagttggtgattctaatgttgatggtggtgccaagacttcagacaaa
cagaaaaagaaggccaaaatgacagatgaagagattatggagaaattaagaactattgta
agcataggtgatcctaagaaaaaatatacaagatatgaaaaaattgggcaaggggcttct
ggcacggttttcactgctactgatgtggcactgggacaagaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtaccttgctgggggatcacttacggatgttgtaacagagacctgcatg
gatgaagcacagattgctgctgtatgcagagaatgtttacaggcattggagtttttacat
gctaaccaagtgattcacagagacatcaaaagtgacaatgtgcttttaggcatggaagga
tcggttaaacttactgactttggtttctgtgcccagatcacccctgagcagagcaagcga
agtactatggttggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtagacatatggtctctgggtattatggccattgagatggtagaaggagag
cctccatacctcaatgaaaatcctttgagggccttgtacctgatagcaactaatggaacc
ccagaacttcagaatccagagaaacttaccccaatatttcgagatttcttaaatcgatgt
ttggagatggatgtagagaaaaggggttcagccagagaattgttacagcatccctttctg
aaattggccaaaccattatccagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

DBGET integrated database retrieval system