KEGG   Sus scrofa (pig): 100511837Help
Entry
100511837         CDS       T01009                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100511837 (PAK2)
   04010 MAPK signaling pathway
    100511837 (PAK2)
   04012 ErbB signaling pathway
    100511837 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100511837 (PAK2)
  Cellular commiunity
   04510 Focal adhesion
    100511837 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100511837 (PAK2)
  Development
   04360 Axon guidance
    100511837 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100511837 (PAK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100511837 (PAK2)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100511837 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 456 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALHTKGSETSAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDGGAKTSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRVRPIKH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcaccccctgtgcgaatgagcagt
accatttttagtactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaagcaca
gagaaaggaagtaagaagaaagagaaggaaaggccagaaatttctcctccgtctgatttt
gagcacaccatccatgttggttttgatgctgtcactggagaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcttaaagttctacgactccaacacagtgaagcagaaatacctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcactgcataccaag
ggatcggaaacgtcagcagtagtaacagaggaagacgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacaaaatcaatttatacacggtctgtaattgat
cctattcctgctccagttggtgattctaatgttgatggtggtgccaagacttcagacaaa
cagaaaaagaaggccaaaatgacagatgaagagattatggagaaattaagaactattgta
agcataggtgatcctaagaaaaaatatacaagatatgaaaaaattgggcaaggggcttct
ggcacggttttcactgctactgatgtggcactgggacaagaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtaccttgctgggggatcacttacggatgttgtaacagagacctgcatg
gatgaagcacagattgctgctgtatgcagagaatgtttacaggcattggagtttttacat
gctaaccaagtgattcacagagacatcaaaagtgacaatgtgcttttaggcatggaagga
tcggttaaacttactgactttggtttctgtgcccagatcacccctgagcagagcaagcga
agtactatggttggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtagacatatggtctctgggtattatggccattgagatggtagaaggagag
cctccatacctcaatgaaaatcctttgagggtaagaccaattaaacac

DBGET integrated database retrieval system