KEGG   Sus scrofa (pig): 100511837Help
Entry
100511837         CDS       T01009                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ssc04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ssc04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:ssc04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ssc04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:ssc04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ssc04660]
Organismal Systems; Development; Axon guidance [PATH:ssc04360]
Human Diseases; Cancers; Renal cell carcinoma [PATH:ssc05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 456 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALHTKGSETSAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDGGAKTSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRVRPIKH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcaccccctgtgcgaatgagcagt
accatttttagtactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaagcaca
gagaaaggaagtaagaagaaagagaaggaaaggccagaaatttctcctccgtctgatttt
gagcacaccatccatgttggttttgatgctgtcactggagaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcttaaagttctacgactccaacacagtgaagcagaaatacctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcactgcataccaag
ggatcggaaacgtcagcagtagtaacagaggaagacgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacaaaatcaatttatacacggtctgtaattgat
cctattcctgctccagttggtgattctaatgttgatggtggtgccaagacttcagacaaa
cagaaaaagaaggccaaaatgacagatgaagagattatggagaaattaagaactattgta
agcataggtgatcctaagaaaaaatatacaagatatgaaaaaattgggcaaggggcttct
ggcacggttttcactgctactgatgtggcactgggacaagaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtaccttgctgggggatcacttacggatgttgtaacagagacctgcatg
gatgaagcacagattgctgctgtatgcagagaatgtttacaggcattggagtttttacat
gctaaccaagtgattcacagagacatcaaaagtgacaatgtgcttttaggcatggaagga
tcggttaaacttactgactttggtttctgtgcccagatcacccctgagcagagcaagcga
agtactatggttggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtagacatatggtctctgggtattatggccattgagatggtagaaggagag
cctccatacctcaatgaaaatcctttgagggtaagaccaattaaacac

DBGET integrated database retrieval system