KEGG   Sus scrofa (pig): 100511841Help
Entry
100511841         CDS       T01009                                 

Gene name
UGT1A10, UGT1A3
Definition
UDP glucuronosyltransferase 1 family, polypeptide A10
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ssc  Sus scrofa (pig)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100511841 (UGT1A10)
   00053 Ascorbate and aldarate metabolism
    100511841 (UGT1A10)
   00500 Starch and sucrose metabolism
    100511841 (UGT1A10)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100511841 (UGT1A10)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100511841 (UGT1A10)
   00860 Porphyrin and chlorophyll metabolism
    100511841 (UGT1A10)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100511841 (UGT1A10)
   00982 Drug metabolism - cytochrome P450
    100511841 (UGT1A10)
   00983 Drug metabolism - other enzymes
    100511841 (UGT1A10)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100511841 (UGT1A10)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100511841 (UGT1A10)
Glycosyltransferases [BR:ssc01003]
 Others
  Hydrophobic molecule
   100511841 (UGT1A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 293 aa AA seqDB search
MAPVVLTRFLPLCVCLLLSPGFAEAGKLLVVPMDGSHWFTMRSVVEKLIHRGHEVVLVTP
EVSWQLTNSFNMTVKTYSTTYTLEDLNREFQIFSDFQWKARQMSMFSMLMSESTKFFDYF
FSHCGSLFNDTKLVKYIEESSFDAVFLDPFDMCGLIVAKYFSLPAVVFTRGPFCHHLEES
TQCPMPLSYVPRELSAFSDVMTFGERLRNHIWHLEERLFCHYFVKRALEIASEIFQTKVT
AYDLYSQASVWLLRTDFVLDYPKPVMPNMIFIGGINCHEGKPLPKVRYSPAAY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgtggttttaacccgcttccttcctctctgtgtgtgtctgctgctgtcccct
ggttttgccgaggcaggcaagctgctggtagtacccatggatgggagccactggtttacc
atgcgttcggttgtggagaaactcatccacagaggacatgaggtggtcttggtcacacca
gaggtgagttggcaactgacaaattcattcaatatgacagtgaagacttactccaccacg
tacactctggaggatttgaatcgtgagttccagatcttctctgatttccagtggaaagcc
cggcaaatgagtatgttttctatgttaatgagtgaatccaccaaattttttgactacttt
ttttcacattgtgggagtctgtttaatgacaccaagctggtcaaatacatagaagagagt
tctttcgatgccgtgtttctagatccttttgatatgtgtggcttaattgtagccaagtat
ttttccctcccggctgtggtcttcaccaggggaccattttgccatcatctggaagagagc
actcagtgtcccatgcctctttcttacgttccaagagaactctcagcgttctcggatgtc
atgacttttggggagcgattgcggaatcacatctggcacttggaggaacgtttgttttgc
cactattttgtaaagagagctttagaaattgcctctgagattttccagacgaaggtcaca
gcatacgatctctatagccaagcatcagtttggttgctgcggactgactttgtcttggac
tatcccaaacccgtgatgcccaacatgatcttcatcggaggcatcaactgccacgaggga
aagccattgccaaaggtacgttactctcctgccgcctattaa

DBGET integrated database retrieval system