KEGG   Sus scrofa (pig): 100511913Help
Entry
100511913         CDS       T01009                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5 (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100511913 (KAT5)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100511913 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINGISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttttacgtccattatattgacttcaacaaacgcctggatgaatgggtgactcat
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccaccaag
aacggacttcctgggtcccgccccggctctccagagagagaggtgccggcctccgcccag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcccgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccggtg
cccagcgagacagccccggcctcagtttttccccagaatggatcagcccgtagggcagtg
gcagctcagccagggcggaagcgaaaatcaaattgcttgggcactgacgaggactcccag
gacagctcagacggaataccctcggctcctcgcatgactgggagcctggtgtctgaccgc
agccacgacgacatcgtcacccggatgaagaacattgagtgcatcgagctgggccggcac
cgcctcaagccgtggtacttctccccgtacccgcaggagctcaccaccctgcccgtcctc
tacctctgcgagttctgcctcaagtacggccgaagcctcaagtgtctgcagcgtcacttg
accaagtgtgacctgcgacatcctccaggcaacgagatttaccgaaagggcaccatctcc
ttctttgagatcgatggtcgtaagaacaagagttactctcagaacctgtgtcttctggcc
aagtgtttcctcgaccacaagacgctgtactatgacacggaccccttcctcttctacgtc
atgacggagtatgactgcaagggcttccacattgtgggttacttctccaaggaaaaggaa
tccacggaagactacaacgtggcctgcatcctgaccctgcctccctaccagcgccggggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacaggg
acccctgagaagcccctctcggaccttggcctcctatcctaccgaagctactggtcccag
accattctggagatcttgatggggctgaagtcggagagcggggagaggccgcagatcacc
atcaatgggatcagtgaaatcaccagcatcaagaaggaggacgtcatctccactctacag
tacctcaacctcatcaactactacaagggccagtatatcctcacactgtcggaggacatc
gtggacgggcatgaacgggctatgctcaagcggcttcttcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagaggggaaagtggtga

DBGET integrated database retrieval system