KEGG   Sus scrofa (pig): 100511951Help
Entry
100511951         CDS       T01009                                 

Gene name
CYB5R1
Definition
cytochrome b5 reductase 1
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssc00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 305 aa AA seqDB search
MGFQPSPVLLASLGVGLLSLFGLALGSYLLRRSRRPLVTLLDPNEKYLLRLLDKTTVNHN
TKKFRFALPTAHHVLGLPVGKHVYLSARIDGSLVIRPYTPITSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLNSLKLGDVVEFRGPSGLLTYTGKGKFSIQPNKKSPPEPRVARKLG
MIAGGTGITPMLQLIRAILKDPEDPTQCFLLFANQTEKDIILREDLEELQARHPNQFKLW
FTLDQPPEDWTYSKGFVSADMIREHLPAPAEDVLLLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggttccagccgagtccagtcctgctggcttccctgggggtggggctgctgagtctg
tttggcctagctctgggctcctacctcctgcggagatcccgccggccgctggtcacgctc
ttggaccccaatgaaaagtacctgctgcgactgttagataaaacgaccgtgaaccacaac
actaagaagttccgctttgccctgcccaccgcccaccacgttctggggctgcctgtgggc
aaacatgtctacctctctgcccgcatcgacggcagtcttgtcatcaggccctacactccc
atcaccagcgatgaggaccaaggctacgtggatcttgtcatcaaggtctacctgaagggc
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctgaatagcctgaagctt
ggggatgtggtggagtttcgagggcccagtgggttgctcacttacaccgggaaaggaaag
ttcagcattcagcccaacaagaaatctccgccggaaccccgagtggccaggaaactggga
atgattgccggaggcacagggatcaccccgatgctgcagctgatccgggccatcctgaaa
gacccagaagatccaacccagtgctttctgctttttgccaaccagaccgaaaaggacata
atcttacgggaggacttggaggagctgcaggcacgacaccccaatcagtttaagctctgg
ttcactctggatcagcccccagaagattggacctacagcaagggttttgtgtctgccgac
atgatccgggagcacctgcctgccccagcagaggacgtgttgctgctgctgtgtgggcca
ccccccatggtgcagctggcctgccaccccaacctagacaaactgggctactcacagaag
atgcgcttcacctactga

DBGET integrated database retrieval system