KEGG   Sus scrofa (pig): 100512072Help
Entry
100512072         CDS       T01009                                 

Definition
ubiquitin specific peptidase 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100512072
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100512072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 963 aa AA seqDB search
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNRYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTVPSRN
FTTSPKSSASPYSSVSASPIANGDSTNTSGMHSSGVSRGGSGFSASYNCQESPSSHVQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKISVTFDPFCYLTLP
LPLKKDRVMEIFLVPADPHCRPTQYRVIVPLMGAVSDLCEALSRLSGVAAENMVVTDVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSMDGSECITLPVYFRERKSRPSSTSTGAVL
YGQPLLVSVPKHKLTLEFLYQAVCERISRYIKQPLPDESGSSPLEPGACNGSRGSCEGED
EEEMEHQEEGREQLSETEGSGEDESGSDRGETSQKKLKDRPCPERLFTFSLVNSYGTADI
NSLATDGKLLKLNSRSTLAIDWDSETRNRYYDEQESEAYEKHVSMLQPQKKKKTAVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPVRALNMSEFVCDLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKAPSLSFPGSSDGGTRPGSSQQGMGDDETCSM
DTN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggaggctgccgtgaacgaccggatgcagagacccagaaatccgagctc
ggggccttaatgaggaccacgctgcaacgaggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggcttcgacagctgggatatgtacaatgtgggt
gaacacaatctgtttcctggccccatagataactctggactcttttcagatcctgagagt
cagaccttgaaagaacatttaattgatgaattggactatgtattggtccccactgaggcc
tggaataagttactaaactggtatggctgtgtagaaggtcagcagcccattgtcagaaaa
gttgtagagcatggcctgtttgtcaagcactgcaaggtagaggtgtatttgctggaattg
aagctttgtgagaatagtgatcccaccaatgtgctgagttgccatttcagcaaggcagac
accatcgcaaccatcgagaaggaaatgcggaagctgttcaatatccctgcagagcgtgag
acacggctgtggaacagatacatgagcaacacctatgagcagttgagcaagctagacaac
actgtgcaggatgctgggctgtaccagggtcaggtgctagtaattgagccccaaaatgaa
gatggcacatggccaaggcagaccctgcagtcaaaatcaagcactgtgcctagcagaaat
tttactacctctccaaaatcatcagcaagtccctattcctcagtgtctgcctctcccatt
gcaaatggtgatagcactaacacctctggaatgcacagttccggtgtcagcaggggtgga
tctggcttctctgcttcgtataactgtcaggagtccccatcgtctcacgtacaacctggg
ctctgtggacttggaaacctggggaacacctgcttcatgaactctgctttgcagtgctta
agcaacactgcaccactgactgactactttctcaaagatgagtatgaagctgaaatcaac
agggacaaccctctgggaatgaaaggggaaattgcagaggcctatgcagagctcattaag
cagatgtggtctggaagggatgctcatgtggcacctcgaatgttcaaaacccaggtggga
cgttttgcccctcagttttctggctaccagcagcaagactctcaggagctcttagccttt
cttctagacggattgcatgaagatctgaaccgagtgaagaaaaaaccctacctggagctg
aaggatgccaatgggcggccagatgcggtggtggcaaaggaagcctgggagaatcatagg
ctaaggaatgactctgtgattgtggacacgttccatggcctcttcaaatctactttggtt
tgcccagagtgcgctaagatttctgtgacctttgacccattttgctatctaactctcccc
ctgcccttgaagaaagatcgagttatggagatcttcctggttcctgctgaccctcactgc
aggcctacccagtaccgcgtaattgtgccgctaatgggtgctgtatctgatctgtgcgag
gctctctccaggttgtctggcgttgctgcagaaaacatggtggtcacagatgtgtataat
caccggttccacaaaattttccaaatggatgaaggtttaaaccacatcatgcctcgggat
gatatttttgtgtacgaggtctgcagcacctccatggatggctctgaatgtatcacgctt
cctgtgtacttcagggagaggaagtccaggccgtcgagcacttccaccggggcggtgctg
tatgggcagcctctgttggtttctgtcccaaagcacaagctcaccctcgaatttttgtac
caggctgtttgtgagcgtatcagccgctatataaaacagcctttgcctgatgagtctggc
agctcgcccttggaaccgggggcctgcaatggctctaggggcagctgtgaaggagaagac
gaagaggaaatggagcatcaggaggaaggcagagagcagctttcagaaacagagggcagt
ggggaggatgaatcggggagtgaccgtggtgagacctcccaaaagaagctcaaagacaga
ccctgccctgaaaggctttttaccttcagtcttgtgaactcttatggcacagctgacata
aattcccttgcaactgatgggaagctacttaaactcaactctcggtccacactagccatc
gactgggatagtgagacccggaaccgttattatgatgagcaagaatctgaggcctatgag
aagcatgtcagcatgttgcagcctcaaaagaaaaagaagacagcagtggccctaagagac
tgcatcgagctcttcactaccatggagacccttggggagcacgacccctggtactgtccc
aactgtaagaagcatcaacaggccacaaagaagtttgacttgtggtccttgccgaagatc
ctggttgtccatctcaaacgtttctcctacaatagatactggagggataagcttgatacg
gttgtggaattcccagtcagagctctgaacatgtccgagtttgtctgtgacctgtcagca
aggccttatgtgtacgacctcattgccgtgtccaatcattacggagccatgggggttggc
cactatactgcatacgcgaagaacaaactgaatgggaaatggtattactttgatgatagc
aatgtgtccctggcctctgaggatcagatagtgacaaaagcagcttacgtgctattttac
cagcgtcgagatgatgagttttataaggcaccttcactcagttttcctggatcgtctgat
ggaggaacgagaccaggaagctcacagcaaggcatgggggatgatgagacttgcagcatg
gacaccaactga

DBGET integrated database retrieval system