KEGG   Sus scrofa (pig): 100512129Help
Entry
100512129         CDS       T01009                                 

Gene name
USP32
Definition
(RefSeq) ubiquitin specific peptidase 32
  KO
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100512129 (USP32)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100512129 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 192 aa AA seqDB search
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFASESGSYVIREEMERML
HVVDGKVPDSLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHCK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaaggagtcacggatcggattcctcagctacgaggaggcgctgaggagagtt
acagatgttgagctgaaacgactgaaagatgccttcaagagaacctgtggactctcctat
tacatgggccagcactgcttcatcagggaagtgcttggggacggagtgcctccaaaagtt
gctgaggtgatttactgttcttttggtggaacatccaaaggactgcacttcaataactta
atagttggacttgtccttcttacaagaggcagagatgaggagaaagcaaaatacattttt
agtctttttgcaagcgagtccgggagctatgttatacgggaagaaatggaaagaatgctc
catgtggtggatggtaaagtcccagattcactcaggaagtgtttctcagagggtgaaaag
gtaaactatgaaaagtttagaaattggcttcttctaaacaaagacgcttttaccttctct
cgttggctactgtctggaggtgtatatgtgaccctcactgatgatagtgatactcccact
ttctaccaaactctggctggagtcacacattgtaagtaa

DBGET integrated database retrieval system