KEGG   Sus scrofa (pig): 100512219Help
Entry
100512219         CDS       T01009                                 

Gene name
POM121C
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear envelope pore membrane protein POM 121C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100512219 (POM121C)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100512219 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
3
AA seq 1216 aa AA seqDB search
MSPAAAAAGRGDRRRLIASVRDGRARGWGCGGPAGAALLGLSLLGLVLYLVPAAAALAWL
AVGATAAWWGLSREPRSSRAFSSLVRNARRQRTLLASPPAKSAVNGNLLEPRSLLEGPDP
AELLLMGSYLGKPGPPQPASTPEARDVRERPGRRPPARTAAPALSAHPHRVHTQPSLPTP
LLRPSRRPSHRDCGTLSHRFVITPRRRYPIQQAQYSLLGVLPTVCWNGCHKKTVLSARNS
KMVCSPVTVRIAPPDSKLIRSPLPEQVISSTLSSPSTSAPDPCAKETVLSALKERKKRTV
EEEDQIFADGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRTSSLSSLTSTYTGGIPSSSRNAITSSYSSTRGLSQLWKRSGPSSSPFSSPASSRS
QTPERPAKKIREEELSHHSSSSTPLVTDRESQGEKVADTTTWKKQNSWNSPSTPGSSGQR
KRKVQLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKASLQWFNKILEDKTDTASTSVPE
SPPTSQPSFTFTLPAAGTAVPTTSLPAPSTNPLLESLKKMQNSPGLPSLPESAGMATTVA
HSPPKTPSPLAPLGSSQSGPLPGTSSDSKPTATFLGLTPASPGPVTDTTKSSPAPQAETS
AKSQAPSAPSPTPKQNIPFGMLSTPTANPPASAAPAVSSASPMFSPVFPPPPKSESEGPL
PSSPSKVTATASSSSALPTTTSSPSLTFKPVFSPMGPPASVPTITPFSFKQTAPPATTTS
TPLFTGQASATPAVASVTTASTSTDSALKPTFSFCVSSVTSTPSSVTSTTASTSQLFLFG
TPPASGASFTPAMGSIFQFGKPPAMPASTAVTTFGPSLPSAAQTAASSSTTXFSGFGSTL
TASAPATTSQPTLTFSSTTTPAFNIPFGSSAKPSLPSYPGANPQPSFGATDGQQQGAAKP
TLVPTFGSSFTFGNSAASAPTATPAPAPAPVQPTFGSTTQSAFGGLKATASGFGTAASTQ
PAFGSTTAVFSFGAATTSGFGAATQTTSSGTSSSVFGSTTPSPFTFGGSAAPAGSGGFGI
SVATPGTSSASGAFSFGAGQSGPAGSTTPFGGGLSQNSLGVPSQNTSFAFNVASTPDSKP
VFGGTSTPTFGQNAPAPGVGTSGSSLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKPP
GARQRLQARRQHTRKK
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcagctgcggcggctggaagaggcgaccggcggcggctgatagcgagtgtc
agggacggtcgggcccggggctggggctgcggagggccggcaggggcggcactgctcggc
ctgtcgctgctcggcctcgtgctgtacctggtgccggcggcggctgcgctggcctggcta
gctgtgggggctaccgcggcctggtggggactgagccgcgagccccgaagttcgcgcgcc
ttctcctcgctcgttcggaacgcgcgccgtcagcgaacactgctcgcctcgcccccggcc
aagtcggcagtaaacggaaatcttctagagccgcggagcttactcgaaggacctgacccc
gctgaactgctcctcatgggcagttacctgggcaagcccggccccccgcagcccgcctcc
accccggaggccagggacgtgcgggagaggcccggccgccgcccacctgcccgcaccgcg
gcgccagctctatcagcccatccccaccgcgttcatactcaaccctccctccccactcct
cttctccgaccctctaggaggccttcccaccgggattgtgggactttatcacatcggttt
gtaataacacctcgaagaagatatccaatccagcaggcccaatattccttgctgggggta
cttcccaccgtgtgctggaatggttgccacaagaagactgtgctatccgctcgcaattcc
aaaatggtgtgcagcccagtgacagtgaggattgctcccccggatagcaaattgattcgt
tcccctctaccagagcaggttatcagctcaacactgtcctcaccatcaactagtgcccca
gacccatgtgcgaaggagactgtgctgagtgccctcaaagagaggaagaaaaggacagtg
gaggaagaagaccaaatatttgctgatggccaggaaaataaaagaaggcgccacgatagc
agtgggagtggacattcagcatttgagccgctggtggccaatggagtccctgcctctttt
gtgcctaagcctgggtctctgaagagaggtctcaattcccagagctcagatgaccactta
aataagagatcgcgcacctcttctctgagctccttgacaagcacgtacacaggcggcatc
cccagctccagccgcaatgccattaccagttcttacagttctactcgaggtctctctcag
ctgtggaagaggagtggtcctagttcatctcccttctccagccccgcttcatcccgctcc
cagacgccagagaggccagcaaagaaaataagagaagaggaactttctcatcattctagc
tcttccacgccactggtaacagacagggagtcccagggagagaaggttgcagatacaacc
acatggaagaaacagaactcatggaattccccatcgacacctggcagctcagggcagcgg
aaacggaaagttcagctgctgccgtcccggcgaggggaccagctgaccttgcctccacct
ccccagcttggttattcaatcactgctgaagacttagacttggaaaagaaagcttcgtta
cagtggttcaacaagatcttggaggataagactgatactgcctcgacctctgtccctgag
agcccacctaccagtcagccttccttcacttttaccctgcctgctgctgggactgctgtc
cccacaacctccctcccagccccaagcactaacccactgttggagagcttgaagaagatg
cagaactccccaggcctaccatccctccctgaatctgctggcatggcaaccactgtggcc
cattcacctccgaagacacccagccctctggcccctcttggctcttcacagtcagggcct
cttccgggcacctcctcagactccaaacctacagccactttcttgggactgacccctgct
tcccctggaccagtcactgacaccaccaagtcatctccggcccctcaggctgagacatct
gccaaatcccaagccccgtccgccccatcccccacccccaagcagaacattccttttgga
atgctgagcacccccactgctaaccctcctgcctctgcagctcctgctgtgtcttcagca
tctcccatgttcagtcccgttttcccaccccctcccaaaagcgagagtgaaggccccttg
ccctctagcccttccaaggtcacagccacagcatcctccagctcagccctccccacgact
accagcagcccatccctcaccttcaaacctgtctttagccccatggggccacctgcatct
gtgcccacaataacccccttctccttcaagcaaacagctcctccagccactactacgagc
acccctctcttcaccggccaggccagtgccactcctgcagtggcttctgtgaccacagcc
agcacctccacagactctgctctgaagcccacgttcagcttctgtgtgagcagcgtgacc
agcaccccaagcagcgtgactagcaccactgcttccacctcccagctcttcctctttggg
actccccctgcctctggtgccagcttcaccccagctatgggctccatattccagtttggc
aagcctcctgccatgcctgcttcaacagcagtcaccacctttggcccgtcccttcccagt
gctgctcagacagccgccagcagcagcaccactnggtttagtggttttggcagcaccctt
acagcctccgccccggccaccaccagccagcccacactgacattcagtagcaccaccacc
ccggcattcaacattccctttggctcaagtgccaagccctccctcccatcatacccagga
gccaacccccagcccagcttcggagccactgatgggcagcagcagggggctgccaagcca
acccttgtccccacctttggcagctccttcacatttggaaactctgcagcctccgccccg
actgcaacgccagcgccagccccagccccagtccagccgacctttggcagcaccacacag
tccgctttcggcggcctgaaagccacagcctctggcttcggcaccgctgccagcacccag
ccagcctttggcagcaccacagccgttttctcctttggtgcagccaccacctctggcttt
ggagctgcaacccagaccaccagcagtgggaccagtagctctgtgtttggcagcacgacg
ccatctcccttcacatttgggggatcggcagccccagcgggcagtggaggctttggcatc
agtgtggctaccccaggcaccagctctgcctccggagccttcagcttcggagcaggacag
agtgggcctgctggcagcacgaccccttttgggggaggcttgagccagaacagcctgggc
gtgcccagccagaacacgtcctttgccttcaatgtggccagcacgccggacagcaaacct
gtgtttggaggcacctccacgcccacctttggccagaacgcccctgctcctggggtgggc
acgtcaggcagcagcctctcctttggggcatcctcaacacccacccagggctttgttgga
gtcggacctttcggatctgcggccccttccttttccattggtgcgggatccaagcctccg
ggggctcggcaacggctacaggcccggaggcagcacactcgcaagaagtag

DBGET integrated database retrieval system