KEGG   Sus scrofa (pig): 100512219Help
Entry
100512219         CDS       T01009                                 

Gene name
POM121C
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100512219 (POM121C)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100512219 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1217 aa AA seqDB search
MSPAAAAAGRGDRRRLIASVRDGRARGWGCGGPAGAALLGLSLLGLVLYLVPAAAALAWL
AVGATAAWWGLSREPRSSRAFSSLVRNARRQRTLLASPPAKSAVNGNLLEPRSLLEGPDP
AELLLMGSYLGKPGPPQPASTPEARDVRERPGRRPPARTAAPALSAHPHRVHTQPSLPTP
LLRPSRRPSHRDCGTLSHRFVITPRRRYPIQQAQYSLLGVLPTVCWNGCHKKTVLSARNS
KMVCSPVTVRIAPPDSKLIRSPLPEQVISSTLSSPSTSTPDPCAKETVLSALKERKKRTV
EEEDQIFADGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRTSSLSSLTSTYTGGIPSSSRNAITSSYSSTRGLSQLWKRSGPSSSPFSSPASSRS
QTPERPAKKIREEELSHHSSSSTPLVTDRESQGEKVADTTTWKKQNSWNSPSTPGSSGQR
KRKVQLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKASLQWFNKILEDKTDTASTSVPE
SPPTSQPSFTFTLPAAGTAVPTTSLPAPSTNPLLESLKKMQNSPGLPSLPESAGMATTVA
HSPPKTPSPLAPLGSSQSGPLPGTSSDSKPTATFLGLTPASSPGPVTDTTKSSPAPQAET
SAKSQAPSAPSPTPKQNIPFGMLSTPTANPPASAAPAVSSASPMFSPVFPPPPKSESEGP
LPSSPSKVTATASSSSALPTTTSSPSLTFKPVFSPMGPPASVPTITPFSFKQTAPPATTT
STPLFTGQASATPAVASVTTASTSTDSALKPTFSFCVSSVTSTPSSVTSTTASTSQLFLF
GTPPASGASFTPAMGSIFQFGKPPAMPASTAVTTFGPSLPSAAQTAASSSTTGFSGFGST
LTASAPATTSQPTLTFSSTTTPAFNIPFGSSAKPSLPSYPGANPQPSFGATDGQQQGAAK
PTLVPTFGSSFTFGNSAASAPTATPAPAPAPVQPTFGSTTQSAFGGLKATASGFGTAAST
QPAFGSTTAVFSFGAATTSGFGAATQTTSSGTSSSVFGSTTPSPFTFGGSAAPAGSGGFG
ISVATPGTSSASGAFSFGAGQSGPAGSTTPFGGGLSQNSLGVPSQNTSFAFNVASTPDSK
PVFGGTSTPTFGQNAPAPGVGTSGSSLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKP
PGARQRLQARRQHTRKK
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcagctgcggcggctggaagaggcgaccggcggcggctgatagcgagtgtc
agggacggtcgggcccggggctggggctgcggagggccggcaggggcggcgctgctcggc
ctgtcgctgctcggcctcgtgctgtacctggtgccggcggcggctgcgctggcctggcta
gctgtgggggctaccgcggcctggtggggactgagccgcgagccccgaagttcgcgcgcc
ttctcctcgctcgttcggaacgcgcgccgtcagcgaacactgctcgcctcgcccccggcc
aagtcggcagtaaacggaaatcttctagagccgcggagcttactcgaaggacctgacccc
gctgaactgctcctcatgggcagttacctgggcaagcccggccccccgcagcccgcctcc
accccggaggccagggacgtgcgggagaggcccggccgccgcccacctgcccgcaccgcg
gcgccagctctatcagcccatccccaccgcgttcatactcaaccctccctccccactcct
cttctccgaccctctaggaggccttcccaccgggattgtgggactttatcacatcggttt
gtaataacacctcgaagaagatatccaatccagcaggcccaatattccttgctgggggta
cttcccaccgtgtgctggaatggttgccacaagaagactgtgctatccgctcgcaattcc
aaaatggtgtgcagcccagtgacagtgaggattgctcccccggatagcaaattgattcgt
tcccctctaccagagcaggttatcagctcaacactgtcctcaccatcaactagtacccca
gacccatgtgcgaaggagactgtgctgagtgccctcaaagagaggaagaaaaggacagtg
gaggaagaagaccaaatatttgctgatggccaggaaaataaaagaaggcgccacgatagc
agtgggagtggacattcagcatttgagccgctggtggccaatggagtccctgcctctttt
gtgcctaagcctgggtctctgaagagaggtctcaattcccagagctcagatgaccactta
aataagagatcgcgcacctcttctctgagctccttgacaagcacgtacacaggcggcatc
cccagctccagccgcaatgccattaccagttcttacagttctactcgaggtctctctcag
ctgtggaagaggagtggtcctagttcatctcccttctccagccccgcttcatcccgctcc
cagacgccagagaggccagcaaagaaaataagagaagaggaactttctcatcattctagc
tcttccacgccactggtaacagacagggagtcccagggagagaaggttgcagatacaacc
acatggaagaaacagaactcatggaattccccatcgacacctggcagctcagggcagcgg
aaacggaaagttcagctgctgccgtcccggcgaggggaccagctgaccttgcctccacct
ccccagcttggttattcaatcactgctgaagacttagacttggaaaagaaagcttcgtta
cagtggttcaacaagatcttggaggataagactgatactgcctcgacctctgtccctgag
agcccacctaccagtcagccttccttcacttttaccctgcctgctgctgggactgctgtc
cccacaacctccctcccagccccaagcactaacccactgttggagagcttgaagaagatg
cagaactccccaggcctaccatccctccctgaatctgctggcatggcaaccactgtggcc
cattcacctccgaagacacccagccctctggcccctcttggctcttcacagtcagggcct
cttccgggcacctcctcagactccaaacctacagccactttcttgggactgacccctgct
tcttcccctggaccagtcactgacaccaccaagtcatctccggcccctcaggctgagaca
tctgccaaatcccaagccccgtccgccccatcccccacccccaagcagaacattcctttt
ggaatgctgagcacccccactgctaaccctcctgcctctgcagctcctgctgtgtcttca
gcatctcccatgttcagtcccgttttcccaccccctcccaaaagcgagagtgaaggcccc
ttgccctctagcccttccaaggtcacagccacagcatcctccagctcagccctccccacg
actaccagcagcccatccctcaccttcaaacctgtctttagccccatggggccacctgca
tctgtgcccacaataacccccttctccttcaagcaaacagctcctccagccactactacg
agcacccctctcttcaccggccaggccagtgccactcctgcagtggcttctgtgaccaca
gccagcacctccacagactctgctctgaagcccacgttcagcttctgtgtgagcagcgtg
accagcaccccaagcagcgtgactagcaccactgcttccacctcccagctcttcctcttt
gggactccccctgcctctggtgccagcttcaccccagctatgggctccatattccagttt
ggcaagcctcctgccatgcctgcttcaacagcagtcaccacctttggcccgtcccttccc
agtgctgctcagacagccgccagcagcagcaccactggctttagtggttttggcagcacc
cttacagcctccgccccggccaccaccagccagcccacactgacattcagtagcaccacc
accccggcattcaacattccctttggctcaagtgccaagccctccctcccatcataccca
ggagccaacccccagcccagcttcggagccactgatgggcagcagcagggggctgccaag
ccaacccttgtccccacctttggcagctccttcacatttggaaactctgcagcctccgcc
ccgactgcaacgccagcgccagccccagccccagtccagccgacctttggcagcaccaca
cagtccgctttcggcggcctgaaagccacagcctctggcttcggcaccgctgccagcacc
cagccagcctttggcagcaccacagccgttttctcctttggtgcagccaccacctctggc
tttggagctgcaacccagaccaccagcagtgggaccagtagctctgtgtttggcagcacg
acgccatctcccttcacatttgggggatcggcagccccagcgggcagtggaggctttggc
atcagtgtggctaccccaggcaccagctctgcctctggagccttcagcttcggagcagga
cagagtgggcctgctggcagcacgaccccttttgggggaggcttgagccagaacagcctg
ggcgtgcccagccagaacacgtcctttgccttcaatgtggccagcacgccggacagcaaa
cctgtgtttggaggcacctccacgcccacctttggccagaacgcccctgctcctggggtg
ggcacgtcaggcagcagcctctcctttggggcatcctcaacacccacccagggctttgtt
ggagtcggacctttcggatctgcggccccttccttttccattggtgcgggatccaagcct
ccgggggctcggcaacggctacaggcccggaggcagcacactcgcaagaagtag

DBGET integrated database retrieval system