KEGG   Sus scrofa (pig): 100512494Help
Entry
100512494         CDS       T01009                                 

Gene name
PFN1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
ssc  Sus scrofa (pig)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100512494 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100512494 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100512494 (PFN1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100512494 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH
GGMINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc
gtgaatgggctaacgcttgggggccagaaatgctctgtgatccgggactcactgctgcag
gacggggaatttaccatggatcttcgtaccaagagcactggcggagcccccaccttcaat
atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system