KEGG   Sus scrofa (pig): 100512584Help
Entry
100512584         CDS       T01009                                 

Gene name
PLA2G16
Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00564  Glycerophospholipid metabolism
ssc00565  Ether lipid metabolism
ssc00590  Arachidonic acid metabolism
ssc00591  Linoleic acid metabolism
ssc00592  alpha-Linolenic acid metabolism
ssc01100  Metabolic pathways
ssc04014  Ras signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100512584 (PLA2G16)
   00565 Ether lipid metabolism
    100512584 (PLA2G16)
   00590 Arachidonic acid metabolism
    100512584 (PLA2G16)
   00591 Linoleic acid metabolism
    100512584 (PLA2G16)
   00592 alpha-Linolenic acid metabolism
    100512584 (PLA2G16)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100512584 (PLA2G16)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100512584 (PLA2G16)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100512584 (PLA2G16)
    3.1.1.32  phospholipase A1
     100512584 (PLA2G16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N Churchill Peptidase_C97
Motif
Other DBs
NCBI-GeneID: 100512584
NCBI-ProteinID: NP_001231443
Ensembl: ENSSSCG00000026914
Vega: OTTSUSG00000002502
UniProt: M3TYH4
Position
2
AA seq 162 aa AA seqDB search
MRALIPEPQLGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEIAGAGAASLMSALTDKALV
KKELLYEVAGRDRYQVNNKHDGKYSPLPPSKIVQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDAIMAAGIAGVGLAAVSFIGVMLSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctgattccagagccccagcttggagacctcattgagattttccgccctttc
tacagacattgggccatttacgttggcgatggatatgtggtccacctggctcccccaagc
gaaattgcgggagctggcgcggccagcctcatgtccgcgctgaccgacaaggccctggtg
aagaaggaactgctgtacgaggtggcggggcgagaccggtaccaggtcaacaacaagcat
gatggcaagtactcaccgctgcctcccagcaaaatcgtccagcgggcggaggagctggtg
ggccaggaggtgctctacaagctgaccagcgagaactgcgagcactttgtcaacgagctg
cgctacggggtcgcccgcagcgaccaggtcagagatgccatcatggcagctggcatcgca
ggagtgggcctggctgctgtgagcttcattggcgtcatgctctccagaaacaagcggcaa
aagcaatga

DBGET integrated database retrieval system