KEGG   Sus scrofa (pig): 100512584Help
Entry
100512584         CDS       T01009                                 

Gene name
PLA2G16
Definition
phospholipase A2, group XVI (EC:3.1.1.4)
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ssc00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ssc00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ssc00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ssc04014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 162 aa AA seqDB search
MRALIPEPQLGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEIAGAGAASLMSALTDKALV
KKELLYEVAGRDRYQVNNKHDGKYSPLPPSKIVQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDAIMAAGIAGVGLAAVSFIGVMLSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctgattccagagccccagcttggagacctcattgagattttccgccctttc
tacagacattgggccatttacgttggcgatggatatgtggtccacctggctcccccaagc
gaaattgcgggagctggcgcggccagcctcatgtccgcgctgaccgacaaggccctggtg
aagaaggaactgctgtacgaggtggcggggcgagaccggtaccaggtcaacaacaagcat
gatggcaagtactcaccgctgcctcccagcaaaatcgtccagcgggcggaggagctggtg
ggccaggaggtgctctacaagctgaccagcgagaactgcgagcactttgtcaacgagctg
cgctacggggtcgcccgcagcgaccaggtcagagatgccatcatggcagctggcatcgca
ggagtgggcctggctgctgtgagcttcattggcgtcatgctctccagaaacaagcggcaa
aagcaatga

DBGET integrated database retrieval system