KEGG   Sus scrofa (pig): 100512615Help
Entry
100512615         CDS       T01009                                 

Gene name
ADH1C
Definition
(RefSeq) alcohol dehydrogenase 1C (class I), gamma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00071  Fatty acid degradation
ssc00350  Tyrosine metabolism
ssc00830  Retinol metabolism
ssc00980  Metabolism of xenobiotics by cytochrome P450
ssc00982  Drug metabolism - cytochrome P450
ssc01100  Metabolic pathways
ssc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100512615 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    100512615 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100512615 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100512615 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100512615 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    100512615 (ADH1C)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100512615 (ADH1C)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100512615 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C UDPG_MGDP_dh_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 100512615
NCBI-ProteinID: NP_001230868
Position
8
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELEKPFSIEEVEVAPPKAYEVRIKMVATGICRSDDHVVHGSLVT
PLPTILGHEAAGIVESIGEGVTTVKPGDKVIPLFVPQCGKCSVCKHPEANFCCKNDLTKP
RGTLSDGTSRFTCKGKPILQFLGTSTFTQYTVVDEMSVAKIDAASPLEKVCLIGCGFSTG
YGSAIKVAKVTQGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDINKDKFAKAKEVGATE
CINPQDYEKPIQEVLQEMSGGGVDFSFEAIGRIDTMISALLCCQKAYGVSVIVGVPPNSQ
NISINPMLLLNGRTWEGAIFGGFKSKDSVPKLVADFMAKKFSLGSLITHVLPFEKINEGF
ELLRSGKSIRTILTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaataaaatgcaaagcagctgtgctatgggagctcgagaaa
ccattttccattgaggaggtggaggtcgcacccccgaaggcctatgaagttcgtattaag
atggtggccacaggaatctgtcgctcagatgaccatgtggttcatggatccttggtcaca
cctcttcctacgatcctaggtcacgaggcagctggcattgtggagagcattggtgagggg
gtgactacagtaaaaccaggtgataaagtcatcccactctttgttccccagtgtggaaag
tgcagtgtttgtaaacaccctgaagccaacttttgctgcaaaaatgatctgactaagcct
cgggggacccttagtgatggtaccagcaggttcacctgcaaagggaagcccatcttgcag
tttctcggcaccagcaccttcacccagtacacagtggtggatgagatgtcagtggccaag
atcgatgcagcctcaccactggagaaagtctgtctgattggctgtggattttctactggt
tatgggtctgcaatcaaagttgccaaggtcacccagggctccacctgtgccgtgttcggc
ctcggaggagtcggcctgtctgttgtcatgggctgtaaagcagctggagcagccaggatc
attggagtggacatcaacaaagacaaatttgcaaaagccaaagaggtgggtgccaccgag
tgcatcaaccctcaggactatgagaaacctatccaggaggtgctacaggaaatgagcggt
ggaggcgtggatttttcatttgaagccattgggaggattgacactatgatttctgccttg
ctgtgctgtcaaaaagcatacggcgtaagcgtcattgtaggagtacctcctaattctcaa
aatatctctataaaccccatgttgctattgaatggacgcacctgggaaggagctattttt
ggtggctttaaaagtaaagattctgtccccaaacttgtggctgattttatggctaagaag
ttttcactgggttcattaataacccatgttttaccctttgaaaaaatcaatgaaggattt
gaactgcttcgctcaggaaagagtatccgtactatcctgacattttga

DBGET integrated database retrieval system