KEGG   Sus scrofa (pig): 100512676Help
Entry
100512676         CDS       T01009                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8
  KO
K06584  integrin alpha 8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04512  ECM-receptor interaction
ssc04514  Cell adhesion molecules (CAMs)
ssc04810  Regulation of actin cytoskeleton
ssc05165  Human papillomavirus infection
ssc05410  Hypertrophic cardiomyopathy (HCM)
ssc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ssc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100512676 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100512676 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    100512676 (ITGA8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100512676 (ITGA8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100512676 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100512676 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100512676 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    100512676 (ITGA8)
  Infectious diseases
   05165 Human papillomavirus infection
    100512676 (ITGA8)
Cell adhesion molecules [BR:ssc04515]
 Integrins
  Integrin alpha subunits
   100512676 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 100512676
NCBI-ProteinID: XP_020920493
Ensembl: ENSSSCG00000011046
Position
10
AA seq 1062 aa AA seqDB search
MSARARCSLRDSRAPLLAPLCCFSAALGMLWSPVSQAFNLDVDKLTVYSGPEGSYFGYAV
DFHIPAARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAY
AEYSPCRNGNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
FKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELLAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTIAVSDVNNDGMDDILIGAPLFMEREFESNPREVGQVY
LYLQVSALVFRDPQVLAGTEVFGRFGTAVAHLGDLNQDGYNDIAIGAPFAGKGQRGKVLI
YNGNENGLNTKASQILQGVWASQAAPSGFGFTLRGDADIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVEAQLLLQPVIINLENKTCQIPESTASVACFSLRVCASVTGQSISNIIRLSAE
VQLDSLKQKGAVKRTLFLDNHQSHRIFPLVVKGQKSLQCQDFTVYLRDETEFRDKLSPIN
ISLNYSLDESTFKEGPEVKPILNHYRASVVTEQAHILVDCGEDNMCIPDLKLSARPDKQQ
VIIGDENHLMLLINARNEGEGAYEAELFVTIPEEADYVGIERSNKGVRPLSCEYKMENVT
RMVVCDLGNPMVAGTNSSLGLRFAVPRLEKTNMSINFELQIRSSNKDNPDSNLVSLQINI
TAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHREEGVGPLVEHIYELHNIGPSTISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLHCQTNPDINPQDIKPAAPLEDTPELSAFLRNSTIPH
RVRRRDVPVLEPHRQSPAKILNCTNIECLQISCVVGRLGGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDMTDREQLTNEKTPEA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcgagcccgctgcagtctccgggatagccgggcgccgctgctcgcgcccctc
tgctgcttctctgccgcgctggggatgctgtggtccccggtctcgcaggcgttcaacttg
gacgtggacaagctcaccgtgtacagcggccccgagggcagctacttcggctacgcggtg
gactttcacatacctgcggctcgcacggcgagcgtcttggtgggggcgcccaaagccaac
accagccagcctgacatcgtggaagggggagctgtctactactgcccctggccagcggag
ggttccgcccagtgcaggcagataccctttgacaacaccaacaacagaaagatcagagta
aatggaaccaaggaacctatagagtttaaatcgaatcaatggtttggagcaacagtgaga
gctcacaaaggaaaagtggtggcctgtgctccattatatcactggagaactcttaaacca
acaccggaaaaggatccagttggtacttgctatgtagcaattcagaatttcagtgcgtat
gctgagtactctccttgtcggaacggtaatgctgatcctgaaggccagggttactgccaa
gcaggatttagtttggatttttataagaatggagacctcatagttggaggccctgggagc
ttttattggcaaggtcaggtgatcactgccagtattgcagatatcattgcgaattactcc
ttcaaggatatcctaaggaaattggccggagaaaaacagacagaagtggctccagcttcc
tacgatgacagttatcttggctattcagttgctgctggggaatttactggagactctcag
caagaattgcttgctggagttccgagaggcgcacagaattttggatatgtttcaatcatc
aactctacagatatgacctttattcagaatttcactggtgaacagatggcatcgtatttt
ggatatacaattgcagtatcagatgttaacaatgacggaatggatgacatattgatcggg
gcgcctctctttatggaacgcgaatttgagagcaaccctagagaagtaggacaagtttac
ctgtatttgcaagtgagtgcactcgtcttcagggacccacaggtccttgccggcacggag
gttttcgggagatttggtaccgccgtggcacatttaggagacctgaaccaagacggatac
aatgacattgccattggtgcgccctttgcaggcaagggtcaacgaggcaaagtgctcatt
tacaacgggaacgagaatggcttaaacaccaaggcttcccaaattcttcaaggagtgtgg
gcctcccaggctgccccttctggatttggctttactttaagaggagatgccgatatagac
aagaatgattacccagatttaattgtgggagcatttggaacaggaaaagtagctgtttac
agagcaaggccagttgttactgtggaagcccagcttctcctgcagccagtgattatcaat
ctggaaaacaaaacctgccagattccagaatctacagcatctgtggcctgcttttctcta
agagtgtgtgcatctgtgacaggccagagcatttcaaacataatacgcctgtctgccgag
gtgcagttagattccctgaaacaaaaaggggccgttaaacgcacactcttccttgataac
catcagtcacatcgcatcttccctctcgtggtaaaggggcagaaatccctccagtgccag
gattttaccgtttaccttcgggacgaaactgaattccgtgataaattatctccaatcaac
attagtttgaattacagtttggacgaatccacctttaaagaaggtccagaagtgaaaccc
atattgaaccactatagggcaagtgttgtcactgaacaggctcacatcttagtcgactgt
ggagaagataacatgtgcattcctgacttgaagctgtcagcgagaccagataagcagcaa
gtcatcatcggagatgaaaaccaccttatgctcctcatcaatgcgagaaatgaaggggaa
ggtgcctacgaagctgagctcttcgtgaccatcccagaagaggctgattatgtcgggatt
gagcgcagcaacaagggggtgcgaccactgagctgtgagtacaagatggaaaatgtaact
cgaatggtggtgtgtgaccttgggaaccctatggtggctggaacaaattcttccttgggc
ctccgatttgcagttccacgtcttgagaaaacaaacatgagcattaacttcgagctccaa
atcagaagttccaacaaggacaacccagacagcaatcttgtgagcctgcagatcaacatc
acggctgtagctcaagtggaaataagaggagtgtcccaccctccgcagatcgtactgccc
attcacaactgggaaccggaagaggagccccacagagaggagggagttggaccattggtg
gaacatatttatgagctgcacaatattggaccgagtacgatcagtgacacccttctggag
gtgggctggccattctctgcccgggatgaatttctcctctacatctttcatattcaaact
ctgggacctctgcactgtcaaacaaatcctgatatcaacccacaggatataaagcccgct
gcccccctggaggacacccctgaactgagcgcctttttgcgaaactccaccattcctcat
cgggtcaggaggagagacgtgccggtgctggagccccacagacagagccccgcaaagatc
ctgaactgcacaaatatcgagtgcttacaaatctcctgtgtggtgggacgactaggagga
ggagaaagtgctgtcctgaaagtcagatcacggctatgggccaagacattcctccagagg
aaaaatgatccctattctcttgcatccctggtgtcctttgaagttaagaagatgccttat
aaagatcagccagcaaaactcccagaaggcagcatagcaattaaaacatcggtaatttgg
gccaccccaaatgtttccttctccatcccattatgggtaataatactggcaatacttctt
gggttactggttctggccattttaaccttggctttatggaagtgcggcttctttgacaga
gccagacccccccaagatgacatgaccgacagggaacagctgaccaatgagaaaacccct
gaggcgtga

DBGET integrated database retrieval system