KEGG   Sus scrofa (pig): 100512676Help
Entry
100512676         CDS       T01009                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
ssc  Sus scrofa (pig)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ssc04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:ssc04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ssc04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:ssc04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:ssc05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:ssc05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:ssc05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 1069 aa AA seqDB search
MSARARCSLRDSRAPLLAPLCCFSAALGMLWSPVSQAFNLDVDKLTVYSGPEGSYFGYAV
DFHIPAASHVSPPGRAASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDNT
NNRKIRVNGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVA
IQNFSAYAEYSPCRNGNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIA
DIIANYSFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELLAGVPRGAQN
FGYVSIINSTDMTFIQNFTGEQMASYFGYTIAVSDVNNDGMDDILIGAPLFMEREFESNP
REVGQVYLYLQVSALVFRDPQVLAGTEVFGRFGTAVAHLGDLNQDGYNDIAIGAPFAGKG
QRGKVLIYNGNENGLNTKASQILQGVWASQAAPSGFGFTLRGDADIDKNDYPDLIVGAFG
TGKVAVYRARPVVTVEAQLLLQPVIINLENKTCQIPESTASVACFSLRVCASVTGQSISN
IIRLSAEVQLDSLKQKGAVKRTLFLDNHQSHRIFPLVVKGQKSLQCQDFTVYLRDETEFR
DKLSPINISLNYSLDESTFKEGPEVKPILNHYRASVVTEQAHILVDCGEDNMCIPDLKLS
ARPDKQQVIIGDENHLMLLINARNEGEGAYEAELFVTIPEEADYVGIERSNKGVRPLSCE
YKMENVTRMVVCDLGNPMVAGTNSSLGLRFAVPRLEKTNMSINFELQIRSSNKDNPDSNL
VSLQINITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHREEGVGPLVEHIYELHNIGPST
ISDTLLEVGWPFSARDEFLLYIFHIQTLGPLHCQTNPDINPQDIKPAAPLEDTPELSAFL
RNSTIPHRVRRRDVPVLEPHRQSPAKILNCTNIECLQISCVVGRLGGGESAVLKVRSRLW
AKTFLQRKNDPYSLASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWV
IILAILLGLLVLAILTLALWKCGFFDRARPPQDDMTDREQLTNEKTPEA
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcgagcccgctgcagtctccgggatagccgggcgccgctgctcgcgcccctc
tgctgcttctctgccgcgctggggatgctgtggtccccggtctcgcaggcgttcaacttg
gacgtggacaagctcaccgtgtacagcggccccgagggcagctacttcggctacgcggtg
gactttcacatacctgcggcgtcgcacgtaagtcccccagggcgtgcggcgagcgtcttg
gtgggggcgcccaaagccaacaccagccagcctgacatcgtggaagggggagctgtctac
tactgcccctggccagcggagggttccgcccagtgcaggcagataccctttgacaacacc
aacaacagaaagatcagagtaaatggaaccaaggaacctatagagtttaaatcgaatcaa
tggtttggagcaacagtgagagctcacaaaggaaaagtggtggcctgtgctccattatat
cactggagaactcttaaaccaacaccggaaaaggatccagttggtacttgctatgtagca
attcagaatttcagtgcgtatgctgagtactctccttgtcggaacggtaatgctgatcct
gaaggccagggttactgccaagcaggatttagtttggatttttataagaatggagacctc
atagttggaggccctgggagcttttattggcaaggtcaggtgatcactgccagtattgca
gatatcattgcgaattactccttcaaggatatcctaaggaaattggccggagaaaaacag
acagaagtggctccagcttcctacgatgacagttatcttggctattcagttgctgctggg
gaatttactggagactctcagcaagaattgcttgctggagttccgagaggcgcacagaat
tttggatatgtttcaatcatcaactctacagatatgacctttattcagaatttcactggt
gaacagatggcatcgtattttggatatacaattgcagtatcagatgttaacaatgacgga
atggatgacatattgatcggggcgcctctctttatggaacgcgaatttgagagcaaccct
agagaagtaggacaagtttacctgtatttgcaagtgagtgcactcgtcttcagggaccca
caggtccttgccggcacggaggttttcgggagatttggtaccgccgtggcacatttagga
gacctgaaccaagacggatacaatgacattgccattggtgcgccctttgcaggcaagggt
caacgaggcaaagtgctcatttacaacgggaacgagaatggcttaaacaccaaggcttcc
caaattcttcaaggagtgtgggcctcccaggctgccccttctggatttggctttacttta
agaggagatgccgatatagacaagaatgattacccagatttaattgtgggagcatttgga
acaggaaaagtagctgtttacagagcaaggccagttgttactgtggaagcccagcttctc
ctgcagccagtgattatcaatctggaaaacaaaacctgccagattccagaatctacagca
tctgtggcctgcttttctctaagagtgtgtgcatctgtgacaggccagagcatttcaaac
ataatacgcctgtctgccgaggtgcagttagattccctgaaacaaaaaggggccgttaaa
cgcacactcttccttgataaccatcagtcacatcgcatcttccctctcgtggtaaagggg
cagaaatccctccagtgccaggattttaccgtttaccttcgggacgaaactgaattccgt
gataaattatctccaatcaacattagtttgaattacagtttggacgaatccacctttaaa
gaaggtccagaagtgaaacccatattgaaccactatagggcaagtgttgtcactgaacag
gctcacatcttagtcgactgtggagaagataacatgtgcattcctgacttgaagctgtca
gcgagaccagataagcagcaagtcatcatcggagatgaaaaccaccttatgctcctcatc
aatgcgagaaatgaaggggaaggtgcctacgaagctgagctcttcgtgaccatcccagaa
gaggctgattatgtcgggattgagcgcagcaacaagggggtgcgaccactgagctgtgag
tacaagatggaaaatgtaactcgaatggtggtgtgtgaccttgggaaccctatggtggct
ggaacaaattcttccttgggcctccgatttgcagttccacgtcttgagaaaacaaacatg
agcattaacttcgagctccaaatcagaagttccaacaaggacaacccagacagcaatctt
gtgagcctgcagatcaacatcacggctgtagctcaagtggaaataagaggagtgtcccac
cctccgcagatcgtactgcccattcacaactgggaaccggaagaggagccccacagagag
gagggagttggaccattggtggaacatatttatgagctgcacaatattggaccgagtacg
atcagtgacacccttctggaggtgggctggccattctctgcccgggatgaatttctcctc
tacatctttcatattcaaactctgggacctctgcactgtcaaacaaatcctgatatcaac
ccacaggatataaagcccgctgcccccctggaggacacccctgaactgagcgcctttttg
cgaaactccaccattcctcatcgggtcaggaggagagacgtgccggtgctggagccccac
agacagagccccgcaaagatcctgaactgcacaaatatcgagtgcttacaaatctcctgt
gtggtgggacgactaggaggaggagaaagtgctgtcctgaaagtcagatcacggctatgg
gccaagacattcctccagaggaaaaatgatccctattctcttgcatccctggtgtccttt
gaagttaagaagatgccttataaagatcagccagcaaaactcccagaaggcagcatagca
attaaaacatcggtaatttgggccaccccaaatgtttccttctccatcccattatgggta
ataatactggcaatacttcttgggttactggttctggccattttaaccttggctttatgg
aagtgcggcttctttgacagagccagacccccccaagatgacatgaccgacagggaacag
ctgaccaatgagaaaacccctgaggcgtga

DBGET integrated database retrieval system