KEGG   Sus scrofa (pig): 100512677Help
Entry
100512677         CDS       T01009                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory-associated protein of mTOR isoform X7
  KO
K07204  regulatory associated protein of mTOR
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04136  Autophagy - other
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04714  Thermogenesis
ssc04910  Insulin signaling pathway
ssc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100512677 (RPTOR)
   04152 AMPK signaling pathway
    100512677 (RPTOR)
   04150 mTOR signaling pathway
    100512677 (RPTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100512677 (RPTOR)
   04136 Autophagy - other eukaryotes
    100512677 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100512677 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100512677 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    100512677 (RPTOR)
  Environmental adaptation
   04714 Thermogenesis
    100512677 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100512677 (RPTOR)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100512677 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT WD40 HEAT_2 Cnd1 HEAT_EZ Raptor_N
Motif
Other DBs
NCBI-GeneID: 100512677
NCBI-ProteinID: XP_013836173
Ensembl: ENSSSCG00000017139 ENSSSCG00000021150
Position
12
AA seq 1166 aa AA seqDB search
MGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAA
CEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDR
RTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPV
SSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVE
NRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSAR
ELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNS
YNTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLC
SLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVRKELVV
ALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVSSYGN
IRAVTTARSLNKSLQNLSLTEEPGGSVAFSPGHLSTSSSASSTLGSPENEDYILSFETVD
KMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMRVLNSIACKATMNA
RPQRILTASSLTQSAPASPTNKGIHIHQAGGSPPTSSTSSSSLTNDVAKQPVSRDLPPGR
PGAAGPVGVQYTPHSHQFPRTRKMFDKGPDQTADDPDDTAGHKSFISATMQTGFCDWSAR
YFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQLIQKGITRLDDQIFLNRNPGV
PSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLL
TATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARKASIFLDRSKQGGAGMVV
DWEQETGLLVSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSRRSLIVAGLGDGS
IRVYDRRMALSECRVMTYREHTAWVVKAHLQKHPEGRIMSVSVNGDVRFFDPRMPESVNV
LQIVKGLTALDIHPQADLIACGSMNQFTAIYNGSGELISNIKYYDGFMGQRVGAISCLAF
HPHWPHLAVGSNDYYISVYSVEKRVR
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccgtccatcttcgtctacgactgctccaacgccggcctcatcgtcaagtcc
ttcaagcagttcgccctgcagcgcgagcaggagctggaggtggccgctatcaaccccaac
cacccactggcccagatgcccttgcccccgtccatgaagaactgcattcagctggcagcc
tgcgaggcccacgagctcctgcccatgatccctgacctcccggccgacctgttcacctcg
tgcctcaccacccccatcaaaatcgccctgcgctggttttgcatgcagaaatgcgtcagc
ctggtgcctggagtcacactggatttgatagaaaagattcccgggcggctcaacgaccgg
cggacgcctctgggggagctcaactggatcttcacagccatcaccgacaccatcgcctgg
aacgtgctgcctcgggatctcttccaaaagctcttcagacaggacctgctggtggctagt
ctgtttcgaaatttcctcttagcggaaaggatcatgaggtcgtataactgcacccccgtg
agcagcccgcgcctgccgcccacttacatgcacgccatgtggcaagcctgggacctggcc
gtggacatctgtctctcgcagctgcccaccatcatcgaggaaggcacggcgttccggcac
agccccttctttgccgagcagctgaccgccttccaggtgtggctcaccatgggcgtggag
aacaggaacccacctgagcagcttcccatcgttttgcaggtcctgctgagccaggtgcac
cggctgagagccctggacttgctgggaagatttctggacctgggtccctgggcggtgagc
ctggcgttgtccgtgggcatcttcccctacgtgctgaagctgctccagagctcggccagg
gagctgcggcctctccttgtcttcatctgggccaagatcctcgccgtggacagctcgtgc
caagcggacctggtgaaggacaacggccacaagtacttcctctccgtcctggcagatccg
tacatgccggctgagcacaggaccatgacggccttcatcctggccgtgatcgtcaacagc
tacaacacggggcaggaggcctgcctccaggggaacctgatcgccatctgcctggagcag
ctcagcgacccccaccccctgctgcgccagtgggtggccatctgcctcgggcggatctgg
cagaacttcgactcggcccgctggtgcggcgtgagggacagcgcccacgagaagctctgc
agcctcctctccgaccccatccccgaggtgcgctgcgcagcagtcttcgcccttggcacc
tttgtgggcaactcagcagagaggacggaccactccaccaccatcgaccacaacgtggcc
atgatgctggcccagctcatcaacgacggcagccctgtggtgcggaaggagctggtggtg
gctctgagtcaccttgtggttcagtacgaaagcaacttctgcaccgtggccctgcagttc
atggaagaggagaagaactacccgctgccctctccggccgccacagagggcgggagtctg
accccggtgcgggacagcccctgcaccccccggctgcgctccgtgagctcctacggcaac
atccgcgcggtcaccacggccaggagcctgaacaagtctttgcagaacctgagcctgacg
gaagaacccggcggctcggtggcgttctctcccgggcacctgagcaccagcagcagcgcc
agcagcaccctgggcagccccgagaacgaggactacatcctctccttcgagacggtggac
aagatgcggcgggtcagctcctactcctccctcaactccctcatcggcgtttcgttcaac
agcgtttacacgcagatctggagagtcctgctgcacctggccgcggacccctacccggac
gtctccgacctggccatgagggtgctcaacagcatcgcctgcaaggccacaatgaacgcc
cggccccagcgcatcctcaccgcctcctcgctcacgcagtcggcacccgccagccccacc
aacaagggcatccacatccaccaggcgggaggctccccgccgacgtccagcaccagcagc
tccagcctgaccaacgacgtggccaagcagccggtcagccgagacctgccgccaggccgg
ccgggcgccgcgggccctgtgggggtgcagtacacgccccactcccaccagttcccccgc
acacgcaagatgttcgacaagggcccggaccagactgccgacgacccggacgacactgcg
gggcacaagagcttcatctcggccacgatgcagacgggcttctgcgactggagcgcgcgg
tactttgcccagcccgtcatgaagatcccggaagagcacgacctggagagtcagatccgc
aaggagcgcgagtggcggtttctgcgcaacacgcgcgtccggaagcaggcgcagcagctc
atccagaaggggatcacgaggctggacgaccagatctttctgaacaggaaccccggcgtc
ccctccgtggtcaagttccatccctttacgccctgtgtggccgtcgccgacaaagacagc
atctgcttttgggactgggagaaaggggagaagctggactatttccacaacgggaaccct
cggtacaccagggtcactgccatggagtatctgaacggccaggactgctcgctcctgctc
acggccacagatgacggcgccatcagagtctggaagaactttgctgacttggaaaagaat
ccggaaatggtgacagcctggcaggggctctcggacatgctgcccaccacccgaggtctg
gcccgaaaggcctccatctttcttgaccgcagtaagcagggaggagcggggatggtggtg
gactgggagcaggagaccggccttctcgtgagctcgggagacgtgcggatcgtccgcatc
tgggacacggaccgcgagatgaaggtgcaggacatccccacgggggccgacagctgcgtg
acgagcctgtcctgcgactcccgccgctccctcatcgtggccgggcttggcgacggctcc
atccgcgtctacgaccggaggatggcgctcagcgagtgccgcgtgatgacctaccgggag
cacacggcctgggtggtgaaggcccacctccagaagcaccccgagggccgcatcatgagc
gtcagcgtcaacggggacgtgcgcttctttgaccctcggatgccggagtccgtgaatgtc
ctgcagatcgtgaaggggctgacggcgctggacatccacccccaggcggacctgatcgcg
tgcggctccatgaaccagttcaccgccatctacaacggcagcggggagctcatcagcaac
atcaagtactacgacggcttcatgggccagcgggtcggcgccatcagctgcctggccttc
cacccccactggcctcacctggccgtgggcagcaacgactactacatctccgtgtactcg
gtggagaagcgcgtcagatag

DBGET integrated database retrieval system