KEGG   Sus scrofa (pig): 100512677Help
Entry
100512677         CDS       T01009                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ssc  Sus scrofa (pig)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100512677
   04152 AMPK signaling pathway
    100512677
   04150 mTOR signaling pathway
    100512677
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100512677
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100512677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1088 aa AA seqDB search
MPTPGFVELSSLLHHRWLPDAKGRDAARVRFCMQKCVSLVPGVTLDLIEKIPGRLNDRRT
PLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSS
PRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENR
NPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSAREL
RPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYN
TGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLCSL
LSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVRKELVVAL
SHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVSSYGNIR
AVTTARSLNKSLQNLSLTEEPGGSVAFSPGHLSTSSSASSTLGSPENEDYILSFETVDKM
RRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMRVLNSIACKATMNARP
QRILTASSLTQSAPASPTNKGIHIHQAGGSPPTSSTSSSSLTNDVAKQPVSRDLPPGRPG
AAGPVGVQYTPHSHQFPRTRKMFDKGPDQTADDPDDTAGHKSFISATMQTGFCDWSARYF
AQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQLIQKGITRLDDQIFLNRNPGVPS
VVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTA
TDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLVSSGDVRIV
RIWDTDREMKVQDIPTGADSCVTSLSCDSRRSLIVAGLGDGSIRVYDRRMALSECRVMTY
REHTAWVVKAHLQKHPEGRIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALDIHPQADL
IACGSMNQFTAIYNGSGELISNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISV
YSVEKRVR
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgcccggtttcgtggaactgtcgagcctccttcatcaccgctggttgcccgac
gcgaagggaagagacgcggcccgtgtacggttttgcatgcagaaatgcgtcagcctggtg
cctggagtcacactggatttgatagaaaagattcccgggcggctcaacgaccggcggacg
cctctgggggagctcaactggatcttcacagccatcaccgacaccatcgcctggaacgtg
ctgcctcgggatctcttccaaaagctcttcagacaggacctgctggtggctagtctgttt
cgaaatttcctcttagcggaaaggatcatgaggtcgtataactgcacccccgtgagcagc
ccgcgcctgccgcccacttacatgcacgccatgtggcaagcctgggacctggccgtggac
atctgtctctcgcagctgcccaccatcatcgaggaaggcacggcgttccggcacagcccc
ttctttgccgagcagctgaccgccttccaggtgtggctcaccatgggcgtggagaacagg
aacccacctgagcagcttcccatcgttttgcaggtcctgctgagccaggtgcaccggctg
agagccctggacttgctgggaagatttctggacctgggtccctgggcggtgagcctggcg
ttgtccgtgggcatcttcccctacgtgctgaagctgctccagagctcggccagggagctg
cggcctctccttgtcttcatctgggccaagatcctcgccgtggacagctcgtgccaagcg
gacctggtgaaggacaacggccacaagtacttcctctccgtcctggcagatccgtacatg
ccggctgagcacaggaccatgacggccttcatcctggccgtgatcgtcaacagctacaac
acggggcaggaggcctgcctccaggggaacctgatcgccatctgcctggagcagctcagc
gacccccaccccctgctgcgccagtgggtggccatctgcctcgggcggatctggcagaac
ttcgactcggcccgctggtgcggcgtgagggacagcgcccacgagaagctctgcagcctc
ctctccgaccccatccccgaggtgcgctgcgcagcagtcttcgcccttggcacctttgtg
ggcaactcagcagagaggacggaccactccaccaccatcgaccacaacgtggccatgatg
ctggcccagctcatcaacgacggcagccctgtggtgcggaaggagctggtggtggctctg
agtcaccttgtggttcagtacgaaagcaacttctgcaccgtggccctgcagttcatggaa
gaggagaagaactacccgctgccctctccggccgccacagagggcgggagtctgaccccg
gtgcgggacagcccctgcaccccccggctgcgctccgtgagctcctacggcaacatccgc
gcggtcaccacggccaggagcctgaacaagtctttgcagaacctgagcctgacggaagaa
cccggcggctcggtggcgttctctcccgggcacctgagcaccagcagcagcgccagcagc
accctgggcagccccgagaacgaggactacatcctctccttcgagacggtggacaagatg
cggcgggtcagctcctactcctccctcaactccctcatcggcgtttcgttcaacagcgtt
tacacgcagatctggagagtcctgctgcacctggccgcggacccctacccggacgtctcc
gacctggccatgagggtgctcaacagcatcgcctgcaaggccacaatgaacgcccggccc
cagcgcatcctcaccgcctcctcgctcacgcagtcggcacccgccagccccaccaacaag
ggcatccacatccaccaggcgggaggctccccgccgacgtccagcaccagcagctccagc
ctgaccaacgacgtggccaagcagccggtcagccgagacctgccgccaggccggccgggc
gccgcgggccctgtgggggtgcagtacacgccccactcccaccagttcccccgcacacgc
aagatgttcgacaagggcccggaccagactgccgacgacccggacgacactgcggggcac
aagagcttcatctcggccacgatgcagacgggcttctgcgactggagcgcgcggtacttt
gcccagcccgtcatgaagatcccggaagagcacgacctggagagtcagatccgcaaggag
cgcgagtggcggtttctgcggaacacgcgcgtccggaagcaggcgcagcagctcatccag
aaggggatcacgaggctggacgaccagatctttctgaacaggaaccccggcgtcccctcc
gtggtcaagttccatccctttacgccctgtgtggccgtcgccgacaaagacagcatctgc
ttttgggactgggagaaaggggagaagctggactatttccacaacgggaaccctcggtac
accagggtcactgccatggagtatctgaacggccaggactgctcgctcctgctcacggcc
acagatgacggcgccatcagagtctggaagaactttgctgacttggaaaagaatccggaa
atggtgacagcctggcaggggctctcggacatgctgcccaccacccgaggagcggggatg
gtggtggactgggagcaggagaccggccttctcgtgagctcgggagacgtgcggatcgtc
cgcatctgggacacggaccgcgagatgaaggtgcaggacatccccacgggggccgacagc
tgcgtgacgagcctgtcctgcgactcccgccgctccctcatcgtggccgggcttggcgac
ggctccatccgcgtctacgaccggaggatggcgctcagcgagtgccgcgtgatgacctac
cgggagcacacggcctgggtggtgaaggcccacctccagaagcaccccgagggccgcatc
atgagcgtcagcgtcaacggggacgtgcgcttctttgaccctcggatgccggagtccgtg
aatgtcctgcagatcgtgaaggggctgacggcgctggacatccacccccaggcggacctg
atcgcgtgcggctccatgaaccagttcaccgccatctacaacggcagcggggagctcatc
agcaacatcaagtactacgacggcttcatgggccagcgggtcggcgccatcagctgcctg
gccttccacccccactggcctcacctggccgtgggcagcaacgactactacatctccgtg
tactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system