KEGG   Sus scrofa (pig): 100512677Help
Entry
100512677         CDS       T01009                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
ssc  Sus scrofa (pig)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100512677 (RPTOR)
   04152 AMPK signaling pathway
    100512677 (RPTOR)
   04150 mTOR signaling pathway
    100512677 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100512677 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100512677 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    100512677 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100512677 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1072 aa AA seqDB search
MQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQ
DLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEE
GTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDL
GPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFL
SVLADPYMPAEHRTMTAFILAVIVNSYNTGQEACLQGNLIAICLEQLSDPHPLLRQWVAI
CLGRIWQNFDSARWCGVRDSAHEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTT
IDHNVAMMLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAA
TEGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARSLNKSLQNLSLTEEPGGSVAFSPGHL
STSSSASSTLGSPENEDYILSFETVDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLA
ADPYPDVSDLAMRVLNSIACKATMNARPQRILTASSLTQSAPASPTNKGIHIHQAGGSPP
TSSTSSSSLTNDVAKQPVSRDLPPGRPGAAGPVGVQYTPHSHQFPRTRKMFDKGPDQTAD
DPDDTAGHKSFISATMQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVR
KQAQQLIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDY
FHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDML
PTTRGLARKASIFLDRSKQGGAGMVVDWEQETGLLVSSGDVRIVRIWDTDREMKVQDIPT
GADSCVTSLSCDSRRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAHLQKHP
EGRIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSMNQFTAIYNGS
GELISNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatgcgtcagcctggtgcctggagtcacactggatttgatagaaaagattccc
gggcggctcaacgaccggcggacgcctctgggggagctcaactggatcttcacagccatc
accgacaccatcgcctggaacgtgctgcctcgggatctcttccaaaagctcttcagacag
gacctgctggtggctagtctgtttcgaaatttcctcttagcggaaaggatcatgaggtcg
tataactgcacccccgtgagcagcccgcgcctgccgcccacttacatgcacgccatgtgg
caagcctgggacctggccgtggacatctgtctctcgcagctgcccaccatcatcgaggaa
ggcacggcgttccggcacagccccttctttgccgagcagctgaccgccttccaggtgtgg
ctcaccatgggcgtggagaacaggaacccacctgagcagcttcccatcgttttgcaggtc
ctgctgagccaggtgcaccggctgagagccctggacttgctgggaagatttctggacctg
ggtccctgggcggtgagcctggcgttgtccgtgggcatcttcccctacgtgctgaagctg
ctccagagctcggccagggagctgcggcctctccttgtcttcatctgggccaagatcctc
gccgtggacagctcgtgccaagcggacctggtgaaggacaacggccacaagtacttcctc
tccgtcctggcagatccgtacatgccggctgagcacaggaccatgacggccttcatcctg
gccgtgatcgtcaacagctacaacacggggcaggaggcctgcctccaggggaacctgatc
gccatctgcctggagcagctcagcgacccccaccccctgctgcgccagtgggtggccatc
tgcctcgggcggatctggcagaacttcgactcggcccgctggtgcggcgtgagggacagc
gcccacgagaagctctgcagcctcctctccgaccccatccccgaggtgcgctgcgcagca
gtcttcgcccttggcacctttgtgggcaactcagcagagaggacggaccactccaccacc
atcgaccacaacgtggccatgatgctggcccagctcatcaacgacggcagccctgtggtg
cggaaggagctggtggtggctctgagtcaccttgtggttcagtacgaaagcaacttctgc
accgtggccctgcagttcatggaagaggagaagaactacccgctgccctctccggccgcc
acagagggcgggagtctgaccccggtgcgggacagcccctgcaccccccggctgcgctcc
gtgagctcctacggcaacatccgcgcggtcaccacggccaggagcctgaacaagtctttg
cagaacctgagcctgacggaagaacccggcggctcggtggcgttctctcccgggcacctg
agcaccagcagcagcgccagcagcaccctgggcagccccgagaacgaggactacatcctc
tccttcgagacggtggacaagatgcggcgggtcagctcctactcctccctcaactccctc
atcggcgtttcgttcaacagcgtttacacgcagatctggagagtcctgctgcacctggcc
gcggacccctacccggacgtctccgacctggccatgagggtgctcaacagcatcgcctgc
aaggccacaatgaacgcccggccccagcgcatcctcaccgcctcctcgctcacgcagtcg
gcacccgccagccccaccaacaagggcatccacatccaccaggcgggaggctccccgccg
acgtccagcaccagcagctccagcctgaccaacgacgtggccaagcagccggtcagccga
gacctgccgccaggccggccgggcgccgcgggccctgtgggggtgcagtacacgccccac
tcccaccagttcccccgcacacgcaagatgttcgacaagggcccggaccagactgccgac
gacccggacgacactgcggggcacaagagcttcatctcggccacgatgcagacgggcttc
tgcgactggagcgcgcggtactttgcccagcccgtcatgaagatcccggaagagcacgac
ctggagagtcagatccgcaaggagcgcgagtggcggtttctgcggaacacgcgcgtccgg
aagcaggcgcagcagctcatccagaaggggatcacgaggctggacgaccagatctttctg
aacaggaaccccggcgtcccctccgtggtcaagttccatccctttacgccctgtgtggcc
gtcgccgacaaagacagcatctgcttttgggactgggagaaaggggagaagctggactat
ttccacaacgggaaccctcggtacaccagggtcactgccatggagtatctgaacggccag
gactgctcgctcctgctcacggccacagatgacggcgccatcagagtctggaagaacttt
gctgacttggaaaagaatccggaaatggtgacagcctggcaggggctctcggacatgctg
cccaccacccgaggtctggcccgaaaggcctccatctttcttgaccgcagtaagcaggga
ggagcggggatggtggtggactgggagcaggagaccggccttctcgtgagctcgggagac
gtgcggatcgtccgcatctgggacacggaccgcgagatgaaggtgcaggacatccccacg
ggggccgacagctgcgtgacgagcctgtcctgcgactcccgccgctccctcatcgtggcc
gggcttggcgacggctccatccgcgtctacgaccggaggatggcgctcagcgagtgccgc
gtgatgacctaccgggagcacacggcctgggtggtgaaggcccacctccagaagcacccc
gagggccgcatcatgagcgtcagcgtcaacggggacgtgcgcttctttgaccctcggatg
ccggagtccgtgaatgtcctgcagatcgtgaaggggctgacggcgctggacatccacccc
caggcggacctgatcgcgtgcggctccatgaaccagttcaccgccatctacaacggcagc
ggggagctcatcagcaacatcaagtactacgacggcttcatgggccagcgggtcggcgcc
atcagctgcctggccttccacccccactggcctcacctggccgtgggcagcaacgactac
tacatctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system