KEGG   Sus scrofa (pig): 100512686Help
Entry
100512686         CDS       T01009                                 

Gene name
IRS1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
ssc  Sus scrofa (pig)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
MicroRNAs in cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100512686 (IRS1)
   04022 cGMP - PKG signaling pathway
    100512686 (IRS1)
   04151 PI3K-Akt signaling pathway
    100512686 (IRS1)
   04152 AMPK signaling pathway
    100512686 (IRS1)
   04150 mTOR signaling pathway
    100512686 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100512686 (IRS1)
   04920 Adipocytokine signaling pathway
    100512686 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100512686 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100512686 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100512686 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100512686 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100512686 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 1241 aa AA seqDB search
MASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAGPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASLVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPN
GHYILPRGGNGHRCLPGAGLGTSPALTGEEAGPASDLDNRFRKRTHSAGTSPTISHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRMPNYRHSAFVPTHSYPEEGLEMHPLERRGGHHR
QDTSSLHTDDGYMPMSPGVAPVPGTRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGSCSPDIGGGPSSGGSSSGAAPSGSSYGKLWTNGVGGHHSHALPHPKLPVES
SSGKLLSCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEL
EESARHQHLRLSSSSGRLLYAAAAEDSSSSTSSDSLGGGYCGARPEPGLPHLHHQVLQPH
LPRKVDTAAQTNNRLARPTRLSLGDPKASTLPRAREQPPQPALLHPPEPKSPGEYVNIEF
GGDQPGYLSGPVASHSAPSVRCSSQLQPAPREENTGAEEYMNMDLGPGRRAIWQESAGVQ
PGRVGPAPPGAASVCRPTRAVPSSRGDYMTMQMGCPRQSYVDTSPVAPISYADMRTGIVV
EEASLPGATAAAPSASSATSASSAAPQGAGELAACSSLLGGPQGPGGLSAFTRVNLSPNR
NQSAKVIRADPQGCRRRHSSETFSSTPSATRAGNTVPFGGGAAVGGGGGGSSSTEAVKRH
SSASFENVWLRPGELGGAPKELAQMCGAAGGLENGLNYIDLDLVKNFKQRPQERPPQPQP
PPPPPPHQPLGNSESSSTSRSSEDLSAYASISFQKQPEDRQ
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctcccgagacggatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaagcgctttttcgtgctgcgggcggccagcgaggctgggggc
cccgcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctggagagctgcttcaacatcaacaagcgggcggattccaagaac
aagcacctggtggccctctacacccgggacgagcactttgccatcgcggcggacagcgag
gccgaacaggacagctggtaccaggccctcctgcagctgcacaaccgtgccaagggccac
cacgacggggccgcaggccctggggcgggaggcggtgggggcagctgcagtggcagctct
ggcctcggcgaggctggggaggacttgagctatggggacgtgcccccaggacccgccttc
aaggaggtttggcaggtgatcctgaaacccaaaggcctgggtcagacaaagaacctgatt
ggcatctaccgcctctgcctgaccagcaagaccatcagtttcgtgaagctgaactcggag
gcggcggctgtggtgctgcagctgatgaacatcaggcgctgtggccactcagagaacttc
ttcttcatcgaagtgggccgttctgcagtgacgggacccggggagttttggatgcaggtg
gatgattctgtggtggcccagaatatgcatgagacaatcctggaggccatgcgggccatg
agcgatgagttccgccctcgaagcaagagccagtcctcctctaactgctccaaccccatc
agtgtacctctgcgcaggcaccacctcaacaaccctccgcccagccaggtggggctgacc
cgccgctcacgcacagagagcatcactgccacctccccggccagcttggtgggcgggaag
cagggctccttccgcgtccgtgcgtccagtgatggcgaaggcaccatgtctcgccccgcc
tctgtggatggcagtcctgtgagccctagcaccaacaggactcacgcccaccggcatcga
ggcagctcccggctgcacccgcctcttaaccacagccgctctattcccatgccttcttct
cgctgctcaccctccgccaccagcccggtcagcctgtcgtccagcagcaccagcggccat
ggctccacctcggactgtctcttcccgcggcggtctagtgcttctgtgtccgggtccccc
agtgacggcggtttcatctcttccgatgagtatggctctagcccctgtgatttccgaagc
tccttccgcagtgtcacgccagattccctgggccacaccccgcccgcccgcggtgaggag
gagctgagcaactacatctgcatggggggcaagggggcctccaccctcgctgcccccaat
ggccactacattttgcctcggggtggcaatggccaccgctgcctcccaggagctggcttg
ggcacgagcccagccctgaccggggaggaagcaggccctgcatctgatctggataaccgg
ttccgaaagcggactcactctgctggcacatcccctactatttcccaccagaagacccca
tcccagtcctctgtggcttccattgaggaatatacagagatgatgccggcctacccacca
ggaggtggcagtggaggccggatgcccaactaccggcactccgccttcgtgcccacccac
tcctaccctgaggagggtctggaaatgcaccccttggagcggcgtgggggtcaccaccgc
caagacacctccagcctccacaccgatgatggctacatgcccatgtccccaggagtagcc
ccagtgcccggcacccgaaagggcagtggggactacatgcccatgagccccaagagcgtg
tctgccccgcagcagatcatcaaccccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtcccccagcggcagctgctctcctgacattggaggtggtcccagc
agcgggggcagcagcagcggtgccgccccttctgggagcagctatggcaagttatggaca
aatggggtagggggccaccactctcacgccctgccacaccccaaactccctgtggagagc
agtagtggcaagctcttgtcttgtacaggtgactacatgaacatgtcgccagtgggggac
tccaacaccagcagcccttccgactgctactatggccccgaagatccccagcacaagcca
gtcctctcctactactcgttgccaaggtccttcaagcacacgcagcgccccggggagctg
gaggagagcgccaggcaccagcacctccgcctttcctccagctccggtcggcttctctat
gctgcggcagcagaagattcgtcgtcatccaccagcagcgacagcctgggcgggggatac
tgtggggctaggcccgagcccggcctcccgcatctccatcatcaggtcctgcagccccat
ctgcctcgaaaggtggacacagcagcccagaccaacaaccgcctggctcggcccacgagg
ctgtccctgggggatcccaaggccagcaccttacctcgggcccgagagcagccgccgcag
ccggccctgctgcaccctccggaacccaaaagtccaggggaatatgtgaatattgaattt
gggggcgatcagccgggctacttatcaggcccggtggcgtcccacagcgcgccttcggtg
agatgttcatcgcagctccagccagctcccagagaagagaacactggcgccgaagagtac
atgaacatggacctggggccaggccggagggcgatctggcaggagagcgctggggtccag
cctggcagggtgggccccgcccccccgggagctgctagcgtgtgcaggccgacccgggcg
gtgcccagcagccggggtgactacatgaccatgcagatgggttgtccccgtcagagctac
gtggacacctcgccagtggcccccatcagctatgccgatatgcggaccggcatcgtcgtg
gaggaggccagccttcccggggccacagcggctgctccctcggcgtcctcggccacctct
gcttcctccgccgcgccccaaggagcaggggagctggcggcctgctcttccctgctgggg
ggcccgcagggacccgggggcctgagcgccttcacacgggtgaatctcagtcccaaccgc
aaccagagtgccaaagtgatccgtgccgaccctcaagggtgcaggaggcggcacagctcc
gagaccttctcctcgacacccagtgccacccgggcgggcaacacggtacccttcggaggg
ggagctgcagtcgggggcggcggtggtggcagcagcagcactgaggctgtgaaacgccac
agctctgcctccttcgagaacgtgtggctgaggcctggggagcttgggggagcccccaag
gagctggcccagatgtgcggagcagctgggggtttggagaatggtcttaactacatagac
ctggatttggtcaagaacttcaaacagcgccctcaagagcgcccccctcaaccgcagcct
cctccaccccctcctcctcatcagcctctgggcaacagtgagagcagctccaccagccgc
tccagcgaggatttaagcgcctatgccagcatcagtttccagaagcagccagaggaccgt
cagtag

DBGET integrated database retrieval system