KEGG   Sus scrofa (pig): 100512775Help
Entry
100512775         CDS       T01009                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
ssc  Sus scrofa (pig)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:ssc00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ssc00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MKPHLKQWRQGVLCGIFAWGLFFVVIFIYFTDSNPAEPAPSSFSFLETRRLLPVQGRQRA
IMGASEGLPESADARRGLLHGHPPGPLHSRPADPQTWAQDGLEDEGFFSPQKGRKSQSAF
PAEIAASDTSGPLSPAKLGWPERVRPEHQARGRRAKRRPRRQGRSVVPEEDGDRLYSPLS
RALLRRLWKGDASSRMLHPRLQKAMGAYLRANKHGVRFRGRRAAGRSRAELLCALRGRVR
VRTLDGTEPPFSALGWRTLVPAVPLGQLLPRGLRSCAVVTSAGAILNSSLGEEIDSHDAV
LRFNSAPTHGYEKDVGNKTTIRIINSQILTNPNHHFIDSSLYKDVILVAWDPAPYSANLN
LWYKKPDYNLFTPYVQHRQRNPNQPFYILHPKFIWQLWDIIQENTREKIQPNPPSSGFIG
VLLMMSLCSEVHVYEYVPSERQTELCHYHELYYDAACTLGAYHPLLYEKLLVQRLNTGAQ
GDLHRKGKVVLPGLRAVRCPPGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggagacaaggggtgctgtgcgggatatttgcctggggg
ctcttcttcgtggtgattttcatctacttcaccgacagcaaccctgccgagcccgcgccc
agctccttctccttcctggagaccaggcgactcctgcccgtgcaggggaggcagagggcc
atcatgggtgcatcggagggcctacccgagagtgcggacgcacgcagggggctgctccat
ggacacccgcccggccccctgcactcgaggccggctgaccctcagacatgggcccaggac
gggttggaagatgaagggttcttttcgccccagaaagggagaaaatctcaaagcgctttc
cccgcggagattgccgcttcggacacgtcggggcccctctcccccgcaaagctgggctgg
cctgagagggttcggccggagcatcaggcccgtgggcggcgggcgaagcgccggccacgg
aggcaggggaggagcgtggtgcctgaggaggacggggaccggctgtactcgcccctgtcc
cgggccctgctgcgccggctctggaagggcgacgcgtcctcgaggatgctgcacccgcgc
ctgcagaaggccatgggcgcctaccttcgtgccaacaagcacggcgtgcgcttccggggg
cgccgggcggccgggcgcagccgggcggagctgctgtgcgcgctgcggggccgcgtgcgg
gtgcgcaccctggatggcaccgagccgcccttctcggcgctcggctggcgcacgctggtc
cccgccgtgccactcggccagttgctcccgcgcgggctccggagctgcgccgtggtcacg
tcagccggtgccatcctcaactcatccctaggcgaggagatagattcgcatgatgcagtt
ttgagatttaactctgctcctacacacggctacgagaaggatgtgggaaataaaaccacc
atccgcatcattaattcccagattctgaccaaccccaaccatcacttcattgacagttcg
ttgtataaagatgtcatcctagtggcgtgggacccagctccttattctgcaaaccttaac
ctgtggtacaagaagccggattacaacctgttcactccatatgttcagcatcgtcagcga
aacccaaaccagccattctacattctgcatcccaaatttatatggcagctctgggacatt
atccaggagaacacgcgggagaagatccagcccaacccgccatcctctggcttcatcggc
gtcctgctcatgatgagcctgtgcagcgaggtgcacgtctacgagtacgtcccgtcggag
cggcagaccgagctgtgccactaccatgagctgtactacgacgccgcctgcacgctgggc
gcctaccacccactgctctacgagaagctgctggtgcagcggctcaacacgggcgcgcag
ggcgacctgcaccgcaagggcaaggtggtgctgcccgggctgcgggctgtgcgctgcccg
ccgggtgcctga

DBGET integrated database retrieval system