KEGG   Sus scrofa (pig): 100512775Help
Entry
100512775         CDS       T01009                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
ssc  Sus scrofa (pig)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100512775
   00514 Other types of O-glycan biosynthesis
    100512775
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100512775
Glycosyltransferases [BR:ssc01003]
 Terminal extension
  Sialyltransferase
   100512775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MKPHLKQWRQGVLCGIFAWGLFFVVIFIYFTDSNPAEPAPSSFSFLETRRLLPVQGRQRA
IMGASEGLPESADARRGLLHGHPPGPLHSRPADPQTWAQDGLEDEGFFSPQKGRKSQSAF
PAEIAASDTSGPLSPAKLGWPERVRPEHQARGRRAKRRPRRQGRSVVPEEDGDRLYSPLS
RALLRRLWKGDASSRMLHPRLQKAMGAYLRANKHGVRFRGRRAAGRSRAELLCALRGRVR
VRTLDGTEPPFSALGWRTLVPAVPLGQLLPRGLRSCAVVTSAGAILNSSLGEEIDSHDAV
LRFNSAPTHGYEKDVGNKTTIRIINSQILTNPNHHFIDSSLYKDVILVAWDPAPYSANLN
LWYKKPDYNLFTPYVQHRQRNPNQPFYILHPKFIWQLWDIIQENTREKIQPNPPSSGFIG
VLLMMSLCSEVHVYEYVPSERQTELCHYHELYYDAACTLGAYHPLLYEKLLVQRLNTGAQ
GDLHRKGKVVLPGLRAVRCPPGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggagacaaggggtgctgtgcgggatatttgcctggggg
ctcttcttcgtggtgattttcatctacttcaccgacagcaaccctgccgagcccgcgccc
agctccttctccttcctggagaccaggcgactcctgcccgtgcaggggaggcagagggcc
atcatgggtgcatcggagggcctacccgagagtgcggacgcacgcagggggctgctccat
ggacacccgcccggccccctgcactcgaggccggctgaccctcagacatgggcccaggac
gggttggaagatgaagggttcttttcgccccagaaagggagaaaatctcaaagcgctttc
cccgcggagattgccgcttcggacacgtcggggcccctctcccccgcaaagctgggctgg
cctgagagggttcggccggagcatcaggcccgtgggcggcgggcgaagcgccggccacgg
aggcaggggaggagcgtggtgcctgaggaggacggggaccggctgtactcgcccctgtcc
cgggccctgctgcgccggctctggaagggcgacgcgtcctcgaggatgctgcacccgcgc
ctgcagaaggccatgggcgcctaccttcgtgccaacaagcacggcgtgcgcttccggggg
cgccgggcggccgggcgcagccgggcggagctgctgtgcgcgctgcggggccgcgtgcgg
gtgcgcaccctggatggcaccgagccgcccttctcggcgctcggctggcgcacgctggtc
cccgccgtgccactcggccagttgctcccgcgcgggctccggagctgcgccgtggtcacg
tcagccggtgccatcctcaactcatccctaggcgaggagatagattcgcatgatgcagtt
ttgagatttaactctgctcctacacacggctacgagaaggatgtgggaaataaaaccacc
atccgcatcattaattcccagattctgaccaaccccaaccatcacttcattgacagttcg
ttgtataaagatgtcatcctagtggcgtgggacccagctccttattctgcaaaccttaac
ctgtggtacaagaagccggattacaacctgttcactccatatgttcagcatcgtcagcga
aacccaaaccagccattctacattctgcatcccaaatttatatggcagctctgggacatt
atccaggagaacacgcgggagaagatccagcccaacccgccatcctctggcttcatcggc
gtcctgctcatgatgagcctgtgcagcgaggtgcacgtctacgagtacgtcccgtcggag
cggcagaccgagctgtgccactaccatgagctgtactacgacgccgcctgcacgctgggc
gcctaccacccactgctctacgagaagctgctggtgcagcggctcaacacgggcgcgcag
ggcgacctgcaccgcaagggcaaggtggtgctgcccgggctgcgggctgtgcgctgcccg
ccgggtgcctga

DBGET integrated database retrieval system