KEGG   Sus scrofa (pig): 100512795Help
Entry
100512795         CDS       T01009                                 

Gene name
ADH7
Definition
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100512795 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    100512795 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100512795 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100512795 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100512795 (ADH7)
   00982 Drug metabolism - cytochrome P450
    100512795 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100512795 (ADH7)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100512795 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 436 aa AA seqDB search
MVKDPVSAVEGQQIQAAFPSKCGLHDDASSQNQQCTGGSEGHRNEVCGLQLRCVLPLLSP
SFQTVIKCKAAVLWEQKQPFSIEEIEVAPPKAKEVRIKILATGICRTDDHVIKGEMVSKF
PVIVGHEATGVVESIGDGVTTVKPGDKVIPLFLPQCRECSFCRNPDGNLCVRSDITGRGV
LADGTTRFTCKGQPVYHFMNTSTYTEYTVVDETSVAKIDDAAPPEKVCLIGCGFSTGYGA
AVKTGKVTPGSTCVVFGLGRSGLSSGLSVIMGCKLAGASRIIGIDLNKDKFEKAMAVGAT
ECISPKDSPKPISEVLSEMTGDTVGYSFEVIGRLETMIDALASCNMNYGVSVVVGAPPSA
KMLTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTDFLAKKFDLDQLITHILPFKQINEG
FELLYSGQSIRTVLTF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaggatccagtgtcagccgtggaaggtcagcagatacaggcagcatttccctca
aagtgtggtcttcatgatgacgctagcagccagaaccagcagtgcaccggagggagtgaa
ggacatcgcaatgaggtctgtgggctccagctcaggtgtgtactgcctttgctatcgcct
tcatttcagacagttattaaatgtaaagcagctgtgctctgggaacagaagcaacccttc
tccattgaagaaatagaagttgccccaccaaaggctaaagaagttcgtattaagattttg
gccacaggaatctgtcggacagatgaccacgtgataaaaggagaaatggtgtctaagttt
ccagtgattgtgggacatgaagccacaggggtcgtggagagcattggagacggagtcacc
acagtgaaaccaggtgacaaagtcatccccctctttctgcctcagtgcagagaatgcagt
ttttgtcgcaacccagatggcaacctttgtgtaaggagcgacattactgggcgtggagtc
ctggctgatggaaccaccagattcacgtgcaaaggccaaccagtctatcacttcatgaac
accagtacatatacagagtacacagtggtggatgagacttcagttgctaagatcgatgat
gcagctcctcccgagaaagtctgtttaattggatgtggattttccactggatatggggcc
gctgtcaaaacaggcaaggtcacccctggttcgacttgcgtggtctttggcctgggaaga
agtggcctttcgagtggcctttcggttatcatgggctgtaagttggctggtgcatccagg
atcattgggattgacctcaacaaagacaaatttgagaaagccatggctgtaggggccact
gagtgcatcagccctaaggactcccccaaacccatcagtgaggtgctgtcagaaatgaca
ggagacactgttggctacagttttgaagttattgggcgtcttgaaactatgattgatgcc
cttgcatcctgcaatatgaactatggggtcagcgtggtggtaggagctccgccatcagcc
aaaatgctcacctatgacccaatgctgctcttcactggacgcacgtggaagggttgtgtt
tttggaggttggaaaagcagagatgatgttccaaaactagtaaccgatttcctggcaaag
aaatttgacctggaccaactgataacccacattttaccttttaaacaaatcaatgaagga
ttcgaacttctctactcagggcaaagcattcgcactgtcctgacattttaa

DBGET integrated database retrieval system