KEGG   Sus scrofa (pig): 100513005Help
Entry
100513005         CDS       T01009                                 

Gene name
THBS4
Definition
(RefSeq) thrombospondin-4
  KO
K04659  
thrombospondin 2/3/4/5
Organism
ssc  Sus scrofa (pig)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100513005 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100513005 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100513005 (THBS4)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100513005 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100513005 (THBS4)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100513005 (THBS4)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100513005 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100513005 (THBS4)
  Exosomal proteins of bladder cancer cells
   100513005 (THBS4)
Cell adhesion molecules and their ligands [BR:ssc04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100513005 (THBS4)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100513005 (THBS4)
   VNR
     100513005 (THBS4)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100513005 (THBS4)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100513005 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 961 aa AA seqDB search
MLATRGAALLLLHLALQPWLAAGAQATPQVFDLLPSASQRLNPSVLQPILSDPTLNELYV
ISTFKLQTKSSATIFGLYSSADNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLA
DGRRHRLLLRLTNLHRGAGSVELYLDCTQVDSIHNLPRAFAGLSQSPGSVELRTFQRKAQ
DSLEELKLVVRGSLFQAASLQDCFLQQSEPLAATNTGDFNRQFLGQMSQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVAPAPPASPTPPVRRCDSNPCFRGVR
CTDTRDGFQCGPCPEGYTGNGVTCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGP
TVQGVGINFAKTNKQVCTDIDECRNGACVLNSICVNTLGSYRCGPCKPGYIGDQMRGCKM
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNMDQRNSDKDIYG
DACDNCRNVLNNDQRDTDGDGKGDACDDDMDGDGIKNILDNCPKVANRNQQDRDGDGVXD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPGQEDSNSDGVGDICETDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgttggccacgcgcggagccgccctgcttctcctgcacctggccctgcagccgtggctg
gcggccggcgcccaggccaccccccaggtctttgaccttctgccatccgccagccagagg
ctgaacccgagtgttctgcagcccatcctgtcagaccccaccctgaacgagctctatgtg
atctccaccttcaagctgcagacgaaaagttcagccaccatcttcggcctttactcttct
gctgacaacagcaaatattttgaatttactgtgatggggcgcttaaacaaagccatcctc
cgctatctgaagaatgatgggaagattcacttggtggttttcaacaacctgcagctggct
gacggcagacggcacaggctgctcctgagactgaccaacctgcaccgaggggccggctcc
gtggagctctacctggactgcacccaagtggattccattcacaatctccccagggccttt
gctggcctctcccagagtcccggatctgttgaattgaggactttccagaggaaggcccag
gactccttggaagagctgaagctggtggtgagaggctcactgttccaggcggccagcctg
caagactgcttcctgcagcagagtgagccactggctgccacgaacacaggagactttaat
cggcagttcttggggcaaatgtcacaactaaaccagctgctgggagaggtgaaggatctt
ctgagacaacaggtcaaggaaacatcatttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcagctttcagtctccaaccccaaacaccctggtggcccccgcaccccca
gcctccccgacaccccccgtgcgccggtgtgactccaacccgtgcttccgcggcgtccga
tgcactgacaccagagacggctttcagtgtgggccctgccccgagggctacacaggaaat
ggggtcacctgttctgacgtggatgagtgcagataccatccctgctacccaggcgtgcgc
tgcgtgaacttggctcctggcttcagatgtgacgcctgcccagtgggcttcacggggccc
acagtgcagggtgttgggatcaactttgccaagacaaacaagcaggtctgcacagatatt
gatgagtgtcgaaacggagcatgtgttctcaattctatctgtgttaacaccttgggatct
taccgctgcgggccttgtaaaccagggtacatcggcgatcagatgaggggctgcaaaatg
gagagaaactgcagaaatccagagctgaacccttgcagtgtgaacgcgcagtgtatcgaa
gagaggcagggggatgtgacgtgcgtgtgtggggtcggctgggctggtgatggctacatc
tgtggaaaagacgtggacatcgacagttacccagatgaagaactgccgtgctctgccaga
aactgcaaaaaagacaactgcaagtatgtgccaaattctggccaagaagatgcagacaga
gatggcatcggagatgcttgtgacgaggatgctgatggagatgggatcctgaatgagcag
gataactgtgtcctgacccacaacatggatcagaggaacagtgacaaagatatctatgga
gatgcctgtgataactgccggaatgtcctaaataatgaccagagagacactgatggggat
ggaaaaggagatgcctgcgacgatgacatggatggagatggaataaaaaacatcctggac
aactgccccaaagttgccaatcgtaaccagcaagaccgggatggtgatggcgtgngggat
gcctgtgacagttgtcctgatgtcagcaaccctaaccagtctgacgtggataatgacctg
gttggggactcctgtgacaccaatcaggacagtgacggagacgggcaccaggacagcacg
gacaactgccccactgtcattaacagtgcccagctggacactgacaaggatggaattggc
gacgagtgtgatgatgacgatgacaatgacggcatcccagacctagtgccccctggaccg
gacaattgccggctggtccccaacccaggccaggaggacagcaacagcgacggcgtggga
gacatctgcgagaccgactttgaccaggaccaggtcatcgaccgtatcgacgtctgcccg
gagaatgccgaggtcaccctgaccgacttcagggcctaccagactgtggtcctggaccct
gaaggggacgcccagatcgatcccaattgggtggtcctgaaccagggcatggagatcgtg
cagaccatgaacagcgatcccggcctggccgtgggctacacggcttttaatggggttgac
ttcgaagggaccttccacgtcaacacccaaacggacgatgactatgctggctttatcttc
ggttaccaagacagctccagcttctacgtggtcatgtggaagcagacagagcagacatac
tggcaggccaccccattccgagccgttgcagaacccggcatccagctcaaggcggttaag
tctaagacaggaccaggggagcatctccgcaactccctgtggcacacgggggacaccagc
gaccaggtcaggctgctgtggaaggactccaggaacgtgggctggaaggacaaggtgtcc
tatcgctggttcctgcagcaccggccccaggtgggctacatcagggtgcgattttatgag
ggctccgagttggtggctgactccggggtcaccatagacaccaccatgcgtggaggccgg
cttggcgtgttctgcttctcccaggaaaacatcatctggtccaacctcaagtatcgctgc
aatgacaccatcccagaggacttccaagagtttcagacccagaatttcgatcgcctggat
aactaa

DBGET integrated database retrieval system