KEGG   Sus scrofa (pig): 100513005Help
Entry
100513005         CDS       T01009                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ssc  Sus scrofa (pig)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ssc04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:ssc04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:ssc04510]
Human Diseases; Infectious diseases; Malaria [PATH:ssc05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 880 aa AA seqDB search
MLATRGAALLLLHLALQPWLAAGAQATPQVFDLLPSASQRLNPSVLQPILSDPTLNELYV
ISTFKLQTKSSATIFGLYSSADNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLA
DGRRHRLLLRLTNLHRGAGSVELYLDCTQVDSIHNLPRAFAGLSQSPGSVELRTFQRKAQ
DSLEELKLVVRGSLFQAASLQDCFLQQSEPLAATNTGDFNRQFLGQMSQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVAPAPPASPTPPVRRCDSNPCFRGVR
CTDTRDGFQCGPCPEGYTGNGVTCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGP
TVQGVGINFAKTNKQVCTDIDECRNGACVLNSICVNTLGSYRCGPCKPGYIGDQMRGCKM
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNMDQRNSDKDIYG
DACDNCRNVLNNDQRDTDGDGKGDACDDDMDGDGIKNILDNCPKVANRNQQDRDGDGVXD
ACDSCPDVSNPNQVSDGVGDICETDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFG
YQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSD
QVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRL
GVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgttggccacgcgcggagccgccctgcttctcctgcacctggccctgcagccgtggctg
gcggccggcgcccaggccaccccccaggtctttgaccttctgccatccgccagccagagg
ctgaacccgagtgttctgcagcccatcctgtcagaccccaccctgaacgagctctatgtg
atctccaccttcaagctgcagacgaaaagttcagccaccatcttcggcctttactcttct
gctgacaacagcaaatattttgaatttactgtgatggggcgcttaaacaaagccatcctc
cgctatctgaagaatgatgggaagattcacttggtggttttcaacaacctgcagctggct
gacggcagacggcacaggctgctcctgagactgaccaacctgcaccgaggggccggctcc
gtggagctctacctggactgcacccaagtggattccattcacaatctccccagggccttt
gctggcctctcccagagtcccggatctgttgaattgaggactttccagaggaaggcccag
gactccttggaagagctgaagctggtggtgagaggctcactgttccaggcggccagcctg
caagactgcttcctgcagcagagtgagccactggctgccacgaacacaggagactttaat
cggcagttcttggggcaaatgtcacaactaaaccagctgctgggagaggtgaaggatctt
ctgagacaacaggtcaaggaaacatcatttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcagctttcagtctccaaccccaaacaccctggtggcccccgcaccccca
gcctccccgacaccccccgtgcgccggtgtgactccaacccgtgcttccgcggcgtccga
tgcactgacaccagagacggctttcagtgtgggccctgccccgagggctacacaggaaat
ggggtcacctgttctgacgtggatgagtgcagataccatccctgctacccaggcgtgcgc
tgcgtgaacttggctcctggcttcagatgtgacgcctgcccagtgggcttcacggggccc
acagtgcagggtgttgggatcaactttgccaagacaaacaagcaggtctgcacagatatt
gatgagtgtcgaaacggagcatgtgttctcaattctatctgtgttaacaccttgggatct
taccgctgcgggccttgtaaaccagggtacatcggcgatcagatgaggggctgcaaaatg
gagagaaactgcagaaatccagagctgaacccttgcagtgtgaacgcgcagtgtatcgaa
gagaggcagggggatgtgacgtgcgtgtgtggggtcggctgggctggtgatggctacatc
tgtggaaaagacgtggacatcgacagttacccagatgaagaactgccgtgctctgccaga
aactgcaaaaaagacaactgcaagtatgtgccaaattctggccaagaagatgcagacaga
gatggcatcggagatgcttgtgacgaggatgctgatggagatgggatcctgaatgagcag
gataactgtgtcctgacccacaacatggatcagaggaacagtgacaaagatatctatgga
gatgcctgtgataactgccggaatgtcctaaataatgaccagagagacactgatggggat
ggaaaaggagatgcctgcgacgatgacatggatggagatggaataaaaaacatcctggac
aactgccccaaagttgccaatcgtaaccagcaagaccgggatggtgatggcgtgngggat
gcctgtgacagttgtcctgatgtcagcaaccctaaccaggtgagcgacggcgtgggagac
atctgcgagaccgactttgaccaggaccaggtcatcgaccgtatcgacgtctgcccggag
aatgccgaggtcaccctgaccgacttcagggcctaccagactgtggtcctggaccctgaa
ggggacgcccagatcgatcccaattgggtggtcctgaaccagggcatggagatcgtgcag
accatgaacagcgatcccggcctggccgtgggctacacggcttttaatggggttgacttc
gaagggaccttccacgtcaacacccaaacggacgatgactatgctggctttatcttcggt
taccaagacagctccagcttctacgtggtcatgtggaagcagacagagcagacatactgg
caggccaccccattccgagccgttgcagaacccggcatccagctcaaggcggttaagtct
aagacaggaccaggggagcatctccgcaactccctgtggcacacgggggacaccagcgac
caggtcaggctgctgtggaaggactccaggaacgtgggctggaaggacaaggtgtcctat
cgctggttcctgcagcaccggccccaggtgggctacatcagggtgcgattttatgagggc
tccgagttggtggctgactccggggtcaccatagacaccaccatgcgtggaggccggctt
ggcgtgttctgcttctcccaggaaaacatcatctggtccaacctcaagtatcgctgcaat
gacaccatcccagaggacttccaagagtttcagacccagaatttcgatcgcctggataac
taa

DBGET integrated database retrieval system