KEGG   Sus scrofa (pig): 100513148Help
Entry
100513148         CDS       T01009                                 

Gene name
RAD54B
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA repair and recombination protein RAD54B
  KO
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ssc  Sus scrofa (pig)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100513148 (RAD54B)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100513148 (RAD54B)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     100513148 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
4
AA seq 907 aa AA seqDB search
MRRSAAPSQLQGNPLKKPRFIPPARSDPGLNEEVXKLNSDVKLFEVPANKNAFLQSQNDP
RICSFNLPPEESAREINREDNYREKYHLEASAKTTLDPHHTAHSAPKEVMVSNGQEEEPD
SLVKYFSVVWCKASKKKHKKWEGDAVLIVKGKSFALKDLEGKDIGRGIGYKFKELEKIEE
GQTMMIGGKEIEVMGVISPDDFSSGRCFQLGLSGALNSSQTPKKCTSNPFKSVCKLSSKE
NRQNGFQNCKPRHDPYAPNSLVMLRPDNNHQWMFNKNHFPIVDVVIDPHLVYHLRPHQRE
GIIFLYECVMGMRVNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTLIVT
PGSLVNNWRKEFQKWLGSERIKIFTVDPDHKVEEFTKSPLYSVLIISYEMLLRSLDQIKN
IKFDLLICDEGHRLKNSAIKTTTALFSLPCEKRIILTGTPVQNDLQEFFSLIDFVNPGIL
GSLSCYRKIYEEPIITSRQPSASQEEKELGERRACELTCLTGLFILRRTQEVINKYLPPK
IENVVFCRPGALQIELYRKLLNSQAVRFCLQGLMENSSHLICIGALKKLCNHPCLLFSSV
KEKECSSAWDENEERRLYEDLLKVFPPDYNPLMFAEEESGKLQVLSKLLAVIHELRPAEK
VVLVSNYTQTLNILQEVCRRHGYGCTRLDGQTPISQRQQIVDGFNSKYSSDFIFLLSSKA
GGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIYQRQ
ISKQDLSGAVVDLTKTSDHIQFSVEELKNLFTLHENSHCVTHDLLDCECTGENHPGDSLE
KFPLSRTCQLGPHQQKSNSLKPLSMSQLKQWKHFSGDHLNLSDPFLERIRGNVSFFFQNI
TNQTTAT
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctgcagcaccaagtcagttgcaagggaatcctttaaaaaaaccaagattt
ataccaccagcaagaagtgatccaggtctgaatgaagaggtanaaaagctgaattcagat
gtaaaattatttgaggttcctgcaaataagaatgcatttctccagtcacaaaatgatccc
agaatatgcagttttaatctgcctcctgaagaaagcgctagagaaattaatcgtgaggat
aattacagggaaaaatatcatttggaagcttctgcaaagacaacattagatccacatcat
acagctcattcagcccctaaagaagtaatggtgtctaatggacaagaagaggaacctgat
agcctggttaaatatttcagtgttgtttggtgtaaggcttcaaagaaaaaacacaaaaag
tgggaaggtgatgctgttcttattgtaaaaggaaagtcatttgcattaaaggatttggaa
ggcaaagacattggaagaggcattggatataaatttaaagaacttgaaaagattgaagag
ggtcaaacaatgatgattggtggaaaagaaatagaagtcatgggtgtaatctctccagat
gatttcagcagtggcagatgttttcagcttggactttctggggccttaaattcttctcaa
actcccaagaagtgtacctctaacccttttaaaagtgtctgtaaactaagttcaaaggaa
aatagacagaatggcttccagaattgcaaaccacgtcatgatccatatgcaccaaattcc
cttgttatgctacgaccagataataatcaccagtggatgttcaataagaaccattttcct
attgtggatgtagtaatagatcctcaccttgtgtatcaccttcgaccacatcagagagaa
ggaatcatattcctttatgaatgtgtgatgggaatgagggtgaacggcagatgtggagct
attcttgctgatgaaatgggtttagggaaaacattgcaatgtatttcactcatctggact
ctacagtgtcagggaccctatggcgggaagccagtaataaagaagacacttattgttaca
cctggaagcttggtgaataattggaggaaagaatttcaaaaatggttaggaagtgaaaga
atcaagatatttactgttgatccggaccacaaagtagaagaattcaccaaatcacctttg
tattctgttcttatcatcagttatgaaatgttacttcgatccctggatcaaattaagaat
ataaaatttgatcttctaatttgtgacgaagggcatcgtttgaagaacagtgccattaag
acaactacagccctctttagcctcccttgtgagaaaaggataattctaactggtactcca
gttcagaatgatctccaagaatttttttcattaattgattttgtaaatccaggaatatta
ggttctttgtcatgttatagaaaaatatatgaagaacccatcattacatcaagacaacct
tctgcttctcaggaagaaaaggagttaggagagagaagagcatgtgaacttacgtgcctc
actgggctctttatcctcagaagaacccaagaagtcataaataaatatcttccacctaaa
atagagaatgttgtcttttgccgaccaggagcactacagattgaactgtatcgaaagctg
ttgaattctcaggctgtcagattctgtcttcaaggactgatggaaaatagttctcatcta
atatgtattggagctcttaaaaaactgtgcaatcacccctgccttttgttcagctcagta
aaagaaaaagagtgcagttcagcttgggatgagaatgaagaaagaagactgtatgaagac
ttgctaaaggtgttcccccctgattacaacccgctcatgtttgctgaggaagagtcagga
aaactgcaggtgctgtccaagctcttagctgttatccatgaacttcgtcctgccgaaaag
gtggtgttggtatccaactatacacaaaccttgaatattttacaagaagtgtgcaggcgt
catggatatggctgtacaagactcgatggacaaacaccgatctctcaaaggcagcagatt
gttgatggctttaatagtaaatactcttctgattttatttttttgttaagttccaaagct
ggtggtgtgggacttaaccttattggaggatctcacttaattctctatgacattgattgg
aatccagccactgatatccaggcaatgtctagagtatggagagatggtcagaaacatccc
gtacatatttatagactcctaaccacaggaacaatagaagaaaagatctatcaaaggcag
atcagtaagcaagatctttctggggcagttgtggacctaaccaagacatcggatcatatt
cagttttcagttgaggaacttaaaaatttgttcacattacacgaaaattcacattgtgtt
actcacgacctgcttgactgtgaatgtacaggagaaaaccatccaggtgattcattggaa
aaattccctctctctagaacttgtcaacttggtccacatcaacagaagtctaactccctg
aaacctctctccatgtcacagctgaagcagtggaaacatttttctggagatcatttaaat
ctttcagatccttttcttgaaagaataagagggaatgtgtcattcttttttcagaatata
accaatcaaacaactgctacataa

DBGET integrated database retrieval system