KEGG   Sus scrofa (pig): 100513148Help
Entry
100513148         CDS       T01009                                 

Gene name
RAD54B
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ssc  Sus scrofa (pig)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssc03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 895 aa AA seqDB search
MRRSAAPSQLQGNPLKKPRFIPPARSDPGLNEEVPANKNAFLQSQNDPRICSFNLPPEES
AREINREDNYREKYHLEASAKTTLDPHHTAHSAPKEVMVSNGQEEEPDSLVKYFSVVWCK
ASKKKHKKWEGDAVLIVKGKSFALKDLEGKDIGRGIGYKFKELEKIEEGQTMMIGGKEIE
VMGVISPDDFSSGRCFQLGLSGALNSSQTPKKCTSNPFKSVCKLSSKENRQNGFQNCKPR
HDPYAPNSLVMLRPDNNHQWMFNKNHFPIVDVVIDPHLVYHLRPHQREGIIFLYECVMGM
RVNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTLIVTPGSLVNNWRKEF
QKWLGSERIKIFTVDPDHKVEEFTKSPLYSVLIISYEMLLRSLDQIKNIKFDLLICDEGH
RLKNSAIKTTTALFSLPCEKRIILTGTPVQNDLQEFFSLIDFVNPGILGSLSCYRKIYEE
PIITSRQPSASQEEKELGERRACELTCLTGLFILRRTQEVINKYLPPKIENVVFCRPGAL
QIELYRKLLNSQAVRFCLQGLMENSSHLICIGALKKLCNHPCLLFSSVKEKECSSAWDEN
EERRLYEDLLKVFPPDYNPLMFAEEESGKLQVLSKLLAVIHELRPAEKVVLVSNYTQTLN
ILQEVCRRHGYGCTRLDGQTPISQRQQIVDGFNSKYSSDFIFLLSSKAGGVGLNLIGGSH
LILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIYQRQISKQDLSGAVVD
LTKTSDHIQFSVEELKNLFTLHENSHCVTHDLLDCECTGENHPGDSLEKFPLSRTCQLGP
HQQKSNSLKPLSMSQLKQWKHFSGDHLNLSDPFLERIRGNVSFFFQNITNQTTAT
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctgcagcaccaagtcagttgcaagggaatcctttaaaaaaaccaagattt
ataccaccagcaagaagtgatccaggtctgaatgaagaggttcctgcaaataagaatgca
tttctccagtcacaaaatgatcccagaatatgcagttttaatctgcctcctgaagaaagc
gctagagaaattaatcgtgaggataattacagggaaaaatatcatttggaagcttctgca
aagacaacattagatccacatcatacagctcattcagcccctaaagaagtaatggtgtct
aatggacaagaagaggaacctgatagcctggttaaatatttcagtgttgtttggtgtaag
gcttcaaagaaaaaacacaaaaagtgggaaggtgatgctgttcttattgtaaaaggaaag
tcatttgcattaaaggatttggaaggcaaagacattggaagaggcattggatataaattt
aaagaacttgaaaagattgaagagggtcaaacaatgatgattggtggaaaagaaatagaa
gtcatgggtgtaatctctccagatgatttcagcagtggcagatgttttcagcttggactt
tctggggccttaaattcttctcaaactcccaagaagtgtacctctaacccttttaaaagt
gtctgtaaactaagttcaaaggaaaatagacagaatggcttccagaattgcaaaccacgt
catgatccatatgcaccaaattcccttgttatgctacgaccagataataatcaccagtgg
atgttcaataagaaccattttcctattgtggatgtagtaatagatcctcaccttgtgtat
caccttcgaccacatcagagagaaggaatcatattcctttatgaatgtgtgatgggaatg
agggtgaacggcagatgtggagctattcttgctgatgaaatgggtttagggaaaacattg
caatgtatttcactcatctggactctacagtgtcagggaccctatggcgggaagccagta
ataaagaagacacttattgttacacctggaagcttggtgaataattggaggaaagaattt
caaaaatggttaggaagtgaaagaatcaagatatttactgttgatccggaccacaaagta
gaagaattcaccaaatcacctttgtattctgttcttatcatcagttatgaaatgttactt
cgatccctggatcaaattaagaatataaaatttgatcttctaatttgtgacgaagggcat
cgtttgaagaacagtgccattaagacaactacagccctctttagcctcccttgtgagaaa
aggataattctaactggtactccagttcagaatgatctccaagaatttttttcattaatt
gattttgtaaatccaggaatattaggttctttgtcatgttatagaaaaatatatgaagaa
cccatcattacatcaagacaaccttctgcttctcaggaagaaaaggagttaggagagaga
agagcatgtgaacttacgtgcctcactgggctctttatcctcagaagaacccaagaagtc
ataaataaatatcttccacctaaaatagagaatgttgtcttttgccgaccaggagcacta
cagattgaactgtatcgaaagctgttgaattctcaggctgtcagattctgtcttcaagga
ctgatggaaaatagttctcatctaatatgtattggagctcttaaaaaactgtgcaatcac
ccctgccttttgttcagctcagtaaaagaaaaagagtgcagttcagcttgggatgagaat
gaagaaagaagactgtatgaagacttgctaaaggtgttcccccctgattacaacccgctc
atgtttgctgaggaagagtcaggaaaactgcaggtgctgtccaagctcttagctgttatc
catgaacttcgtcctgccgaaaaggtggtgttggtatccaactatacacaaaccttgaat
attttacaagaagtgtgcaggcgtcatggatatggctgtacaagactcgatggacaaaca
ccgatctctcaaaggcagcagattgttgatggctttaatagtaaatactcttctgatttt
atttttttgttaagttccaaagctggtggtgtgggacttaaccttattggaggatctcac
ttaattctctatgacattgattggaatccagccactgatatccaggcaatgtctagagta
tggagagatggtcagaaacatcccgtacatatttatagactcctaaccacaggaacaata
gaagaaaagatctatcaaaggcagatcagtaagcaagatctttctggggcagttgtggac
ctaaccaagacatcggatcatattcagttttcagttgaggaacttaaaaatttgttcaca
ttacacgaaaattcacattgtgttactcacgacctgcttgactgtgaatgtacaggagaa
aaccatccaggtgattcattggaaaaattccctctctctagaacttgtcaacttggtcca
catcaacagaagtctaactccctgaaacctctctccatgtcacagctgaagcagtggaaa
catttttctggagatcatttaaatctttcagatccttttcttgaaagaataagagggaat
gtgtcattcttttttcagaatataaccaatcaaacaactgctacataa

DBGET integrated database retrieval system