KEGG   Sus scrofa (pig): 100513720Help
Entry
100513720         CDS       T01009                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ssc  Sus scrofa (pig)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssc00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 219 aa AA seqDB search
MLRRPLAGLAAAALGRATSDGMSGPRPVVLSGPSGAGKSTLLKKLLQEHSSIFGFSVSHT
TRDPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICV
LDVDLQGVRNIKKTDLQPIYIFVQPPSLDVLEQRLRQRNTETEESLAKRLAAAKADMESS
KEPGLFDLIIINDSLDKAYWALKEALSEEIKKAQATGHS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggcggctgcagccctgggccgggccacctcggac
gggatgtcaggaccaagacctgttgtcctgagcggaccctcaggggctgggaagagcacc
ctgctgaagaaactccttcaggaacatagcagcatcttcggcttcagcgtgtcccacact
acaagagatccgagaccaggagaagagaacggcaaagactactactttgtgaccagggag
gtgatgcagcgggacattgctgctggagacttcatcgagcatgctgagttctcagggaac
ttgtatgggaccagcaaagcagctgtgcgggccgtgcaggccatgaaccgcatctgtgtg
ctggatgtggacctgcagggtgtgcgcaacatcaagaagactgacctgcagcccatctac
atcttcgtgcagccaccctcactggatgtcctggagcagcggttgcggcagcggaacaca
gagacagaggagagcctggctaagcgtctggctgccgccaaggctgacatggaaagtagc
aaggagcccggcttgtttgacctgatcatcatcaacgacagtctggacaaggcctactgg
gccctgaaggaggcgctctctgaggaaataaagaaggctcaagcaacgggtcactcctga

DBGET integrated database retrieval system