KEGG   Sus scrofa (pig): 100513802Help
Entry
100513802         CDS       T01009                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100513802 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 740 aa AA seqDB search
MSLHVFSDENVTGDRSTENCDFLFSPLELTGRSSVLRLSQKENVPPKSTAKATKVTFQTP
LRDPQTHRILSPSMGSKLDASSALGDTVGLESSHQGRARKESQQLTKETDTRTTDGILPK
PAVADAHPPPGDPTPASEEQHPDRPPATPLASPDPPSSPQMPERAESQVAPGGQGSCSPA
HSPQRHSRPRPSEDSLAAASAPPPQDRAEEPLGAPGEKGVPSPSAGARGEEPLVDQPGEA
PAGSEDTAGREDAGPAAAGGAPSPSPRKHEAAGQTADRPRGGPVRLEFDFSDSATSKRPP
PLRKRGKTPGLQPPSRRPKAKQGTVSGEAGEGLDGNPLGGDGEARTPEPCPSRPAGPAAA
EDTSPSRQVPSASVDDMPGLQPMAGTPGATGEEGATDASGTPAPTSSPTPPVPCSPGPAP
DLSGEQFRDPADVLGTGAEVDYLEQFGASSFKDSALRKQSLYLKFDPLLQDSPRRPAPTG
PKPSSACGMDAPSSGSAPEAALLDLDFLEAPALPALGPAPSDLGPGGPLLPVGPIVDVLQ
YSQRDLDAAVEATQKENAELRSRCTELQEKVLEMGKIMDRFEETVYQAMEEAQKQKELAR
VEVQKALQEQEHVSGDLRSVEKSFSELFRRFEKQKEVIEGYRTNEASLKKCVEEYMERLE
KEGQRYQALKAHAEEKLQLASEEMAQVRSRAQAEVLALQAVLKKEQMRVQSLEKAMEQKT
KENDELTRICDDLISKMERI
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcacgtcttcagtgatgaaaatgtcactggtgacagaagtacagaaaattgc
gacttcctgttttcaccactggaacttaccggaagatcatctgtcctccggctgtcccag
aaagaaaatgtgccgcccaagagcacagccaaagccacgaaggtgacttttcagacacct
ctgcgggatccacagactcaccggatcttaagtcccagcatgggcagcaagctggacgct
tcttcagctctaggggacaccgttggactagaaagctctcatcaaggccgggcccggaaa
gagagccaacagcttaccaaggaaacagacaccagaaccaccgatggaattctcccgaaa
ccagcagtggccgatgcccatcctcctccgggggacccgacacccgcctctgaagagcag
caccccgacaggcctcccgcaacccccctggccagcccggatccccccagctctccccag
atgccagaacgtgctgagagccaagtggcgcccggcggacaaggctcctgcagccccgct
cacagcccgcagagacacagccgccctcgtccctcagaggacagcctcgcggccgcctcc
gcaccaccgccccaagaccgggcagaggagccgctcggagcccccggggagaagggtgtg
ccctctccctctgccggagcccgaggagaagagcccctggtggaccagccgggcgaggcc
ccggcaggctccgaggacactgctggccgcgaggacgctggccctgctgcggccggaggg
gccccgtcccccagtcctcggaagcacgaggccgcgggccagacggccgaccgtccgagg
ggtgggcccgtgaggctggaatttgacttctctgacagtgccaccagcaaaaggccaccc
ccactgaggaaacgggggaagaccccaggtctccagcctccctcgaggagacccaaggca
aagcaggggacggtctccggggaggcgggcgagggtctggacggcaacccgctcggaggc
gatggggaggcccggaccccggagccctgcccgagcaggccggccgggcccgcggccgca
gaggacacgtctccgagccggcaggtgccttcagcgtcagtggatgacatgccagggctg
cagcccatggcggggaccccaggagccactggcgaggagggggccacagatgcctcgggc
acaccagctcccaccagcagccctacgccccctgttccgtgcagcccagggcctgcccca
gacctgagtggagagcagttccgggaccccgccgacgtcctaggcacgggcgccgaggtg
gactacctggagcagttcggggcctcctcctttaaggactcagccctgcggaagcagtcc
ctgtacctcaagttcgacccgctcctacaggacagccctcggcgaccggcgcccacgggc
cccaagccaagcagcgcatgtggcatggacgccccttcctcgggaagcgccccggaagcc
gcactgctggacctggacttcctagaagcaccggcccttcctgcacttggcccagccccc
agtgacctggggcccgggggcccgctgctgcccgtggggcccatcgtggacgtgctgcag
tacagccagagggacctggacgcagcggtggaagcaacacagaaggagaacgcggagctg
aggagcaggtgcacggagctccaggagaaggtcctagagatggggaagatcatggacagg
tttgaggagaccgtgtaccaggcgatggaggaagctcagaagcagaaggaactcgcccga
gttgaggtccagaaggcgctccaagagcaggagcacgtcagcggcgacctgcgctccgtg
gagaagtccttctccgaactcttcaggcgcttcgagaagcagaaggaagtgatcgaaggc
taccgcacgaacgaggcgtcgctgaagaagtgcgtggaggagtacatggagcggctggag
aaggagggccagcggtaccaggcgctgaaggcccacgcggaggagaagctgcagctggcc
agcgaggagatggcccaggtgcggagcagggcccaggccgaggtcctggcgctgcaggcc
gtcctgaagaaggagcagatgcgcgtccagtcgctggagaaggccatggagcagaagact
aaggaaaatgacgaactgaccagaatctgtgacgacctcatttccaagatggagaggatc
tga

DBGET integrated database retrieval system