KEGG   Sus scrofa (pig): 100513872Help
Entry
100513872         CDS       T01009                                 

Gene name
UGT2B17, UGT2B4
Definition
(RefSeq) UDP-glucuronosyltransferase 2B17
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ssc  Sus scrofa (pig)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100513872 (UGT2B17)
   00053 Ascorbate and aldarate metabolism
    100513872 (UGT2B17)
   00500 Starch and sucrose metabolism
    100513872 (UGT2B17)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100513872 (UGT2B17)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100513872 (UGT2B17)
   00860 Porphyrin and chlorophyll metabolism
    100513872 (UGT2B17)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100513872 (UGT2B17)
   00982 Drug metabolism - cytochrome P450
    100513872 (UGT2B17)
   00983 Drug metabolism - other enzymes
    100513872 (UGT2B17)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100513872 (UGT2B17)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100513872 (UGT2B17)
Glycosyltransferases [BR:ssc01003]
 Others
  Hydrophobic molecule
   100513872 (UGT2B17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 532 aa AA seqDB search
MNKMSLKWLSLLLLLQLTCYFSSGRCGKVLVWPMEYSHWINMKIILEELVSRGHEVTVLT
SPAAVVVDVNKSSTIKFEIFPTSITKDYFDNFVKQFIEKWRHATKDSLWTHLLKIQNFFW
KFSDIALKLCKDAILNKKFMTKLQESRFDVVLADPVIPCGELVAEILNIPLVYSLRFSPG
YSIEKFGGKLPFPPSYVPVVMSELSDHMTFTERVKNMLYVVFLDFWFQTFNEKKWNQFYS
EALGRPTTLFETMGKADMWLIRNYWDFDFPRPLLPNFEFIGGFHCKPAKPLPKELEEFVQ
SSGKDGVIVFTLGSMIKNLTEEKSNMIASALAQIPQKVLWRYTGKKPETLGANTRLYEWI
PQNDLLGHPQTRAFITHCGTNGIYEAIYHGIPMVGIPMFGDQHDNIARLKAKGAAVELNL
HTMTSSDLLNALEAVINNPSYKENAMKLSRIHHDQPIKPLDRAVFWIEFVMRHKGAKHLR
PASHDLTWYQYHSLDVIGFLLACVATIIFLVIKCFLFCCSKFGKTAKKKKRE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatgtctctgaaatggctctcactcctgctgctgctacagctgacgtgctac
tttagctctggcaggtgtggaaaggtgctggtgtggccaatggaatatagtcactggatt
aacatgaagataattctggaggaacttgtcagcaggggtcatgaggtgacggttctgaca
tcgccagctgccgttgttgttgatgtcaacaaatcatctactatcaaatttgagattttc
cctacatcgataactaaagattactttgataattttgtcaagcagtttatcgagaaatgg
agacatgctacaaaagattcactttggacacatcttttaaaaattcaaaatttcttttgg
aaattctctgacattgcactgaagctctgtaaagatgctatattaaacaagaaatttatg
acaaagctacaagaatcaaggtttgatgttgttcttgcagatcccgttataccctgtggt
gagctggtggctgagatactcaacataccgctggtgtacagcctccgcttctctcctggt
tattcaattgaaaaattcggtggaaagcttccattcccaccgtcctatgtacctgttgtt
atgtcagaacttagtgatcacatgacattcacggagagggttaaaaatatgttatatgta
gtttttttggacttctggttccagacatttaatgagaagaagtggaatcaattttacagt
gaagcactaggaaggcccactacattatttgagacaatggggaaagctgacatgtggctc
attcgaaattattgggattttgattttccccgcccactgctaccaaattttgaatttatt
ggaggcttccattgcaaacctgccaaacccctacctaaggagttagaagagtttgttcaa
agctctggaaaagatggagtcattgtgtttactttggggtcaatgatcaagaacctcaca
gaagaaaagtctaatatgattgcatcagcccttgcccagattccacagaaggttctgtgg
aggtacacagggaagaaaccagaaacattaggagccaatactcggctgtatgaatggatt
ccacagaatgatcttcttggtcatccccaaaccagagcttttattactcactgtggaacc
aatgggatctatgaagctatttaccatgggatccctatggtgggaattcccatgtttggt
gatcagcatgataatattgctcgtctaaaagctaaaggggcagctgttgaattaaacttg
cacacaatgacgagttctgatctgcttaatgctttggaggcagttattaacaacccttcc
tataaagaaaatgctatgaagttatcaagaattcaccatgatcaacctataaagcccctg
gaccgagcagtcttctggattgagtttgtcatgcgccacaaaggagccaagcacctgcgg
ccagcttcccacgacctcacctggtaccagtaccactctctggatgtgattgggttcctg
ctggcttgtgtggcaactattatatttctggtcattaaatgtttcctgttttgttgttca
aagtttggtaaaactgcaaagaagaaaaagagagagtag

DBGET integrated database retrieval system