KEGG   Sus scrofa (pig): 100514142Help
Entry
100514142         CDS       T01009                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100514142 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100514142 (GCK)
   00052 Galactose metabolism
    100514142 (GCK)
   00500 Starch and sucrose metabolism
    100514142 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100514142 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    100514142 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100514142 (GCK)
   04910 Insulin signaling pathway
    100514142 (GCK)
   04917 Prolactin signaling pathway
    100514142 (GCK)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100514142 (GCK)
   04950 Maturity onset diabetes of the young
    100514142 (GCK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100514142 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 466 aa AA seqDB search
MATEATRNWAWTALNLAEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRVVDENSLNPGQQLYEKLIGGKYMG
ELVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILSTLGLRP
SATDCDIVRRACESVSTRAAHMCAAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALISAVASKKACMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggaggccacaaggaactgggcctggacagccttgaatctggcggagcagatc
ctggcggagttccagctgcaggaggaggacctgaaaaaggtgatgaggcggatgcagaag
gagatggaccgaggcctgaggctggagacccacgaagaggccagtgtgaagatgctgccc
acctacgtacgctccaccccagaaggctcagaggttggggacttcctctccctggacctg
ggcggcaccaacttcagggtgatgctggtgaaggtgggggaaggcgaggaggggcagtgg
agtgtgaagaccaagcaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctctttgactacatctccgagtgcatctccgacttcctggacaagcatcagatg
aagcacaaaaagctgcccttgggcttcaccttctcctttcccgtgaggcacgaagacatc
gacaagggcatccttctcaactggaccaagggcttcaaggcctcgggagcagaagggaac
aacatcgtggggctcctgcgagatgccatcaaacggagaggggactttgagatggacgtg
gtggcaatggtgaatgacactgtggccacgatgatctcctgctactatgaagaccgccga
tgtgaggttggcatgattgtgggcacgggctgcaacgcctgctacatggaggagatgcag
aacgtggagctggtggaaggggacgagggccgcatgtgtgtcaacactgagtggggcgcc
tttggggactcgggagagctggacgagttcctgctggagtatgaccgcgtggtggacgag
aactccctgaacccgggccagcagctgtacgagaagctcatcggtggcaagtacatgggc
gagctggtgcgactcgtgctgctgaagctcgtggacgagaacctgcttttccacggggag
gcctcggagcagctgcgcacgcgcggcgccttcgagacgcgcttcgtgtcacaggtggag
agcgactcgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgaggccc
tcggccaccgactgcgacatcgtgcgccgcgcctgcgagagcgtgtccacgcgcgccgcg
cacatgtgcgccgcggggctggcaggcgtcatcaaccgcatgcgcgagagccgcagcgag
gacgtgatgcgcatcaccgtgggcgtggacggctccgtgtacaagctgcaccccagcttc
aaggagcggttccacgccagcgtgcgcaggctgacgcccagctgcgaaatcaccttcatc
gagtcggaggagggcagcggccggggcgcggccttgatctccgcggtggcgtctaagaag
gcctgcatgctgggccagtga

DBGET integrated database retrieval system