KEGG   Sus scrofa (pig): 100514142Help
Entry
100514142         CDS       T01009                                 

Gene name
GCK
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc00520  Amino sugar and nucleotide sugar metabolism
ssc00524  Neomycin, kanamycin and gentamicin biosynthesis
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc04910  Insulin signaling pathway
ssc04911  Insulin secretion
ssc04917  Prolactin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04930  Type II diabetes mellitus
ssc04950  Maturity onset diabetes of the young
ssc05230  Central carbon metabolism in cancer
Module
ssc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100514142 (GCK)
   00052 Galactose metabolism
    100514142 (GCK)
   00500 Starch and sucrose metabolism
    100514142 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100514142 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100514142 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100514142 (GCK)
   04910 Insulin signaling pathway
    100514142 (GCK)
   04922 Glucagon signaling pathway
    100514142 (GCK)
   04917 Prolactin signaling pathway
    100514142 (GCK)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100514142 (GCK)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100514142 (GCK)
   04950 Maturity onset diabetes of the young
    100514142 (GCK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100514142 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100514142
NCBI-ProteinID: XP_003134931
Ensembl: ENSSSCG00000016751
Position
18
AA seq 556 aa AA seqDB search
MLSVTTPTPCRPPALPALPDPVPVGRVFQQPPAECSQCQSPGQPAWVTLWVGGPHLHRWA
SDSRAAAQPCASADRSVSTSPEPTSWPLREMATEATRNWAWTALNLAEQILAEFQLQEED
LKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLV
KVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFT
FSFPVRHEDIDKGILLNWTKGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVAT
MISCYYEDRRCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEF
LLEYDRVVDENSLNPGQQLYEKLIGGKYMGELVRLVLLKLVDENLLFHGEASEQLRTRGA
FETRFVSQVESDSGDRKQIYNILSTLGLRPSATDCDIVRRACESVSTRAAHMCAAGLAGV
INRMRESRSEDVMRITVGVDGSVYKLHPSFKERFHASVRRLTPSCEITFIESEEGSGRGA
ALISAVASKKACMLGQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctgtcaccacccctaccccatgccggcctcctgcccttccggctctgcctgac
cctgtgccagtgggcagagtatttcaacagccgcctgctgaatgctctcagtgccaaagc
cctgggcagcccgcgtgggtgactctctgggtaggtggcccgcacctgcacaggtgggcc
tcagactcccgggctgcagcccagccctgcgcctctgcagacaggagtgtctccacctcc
ccagaaccaacctcttggcccctcagagagatggcaacggaggccacaaggaactgggcc
tggacagccttgaatctggcggagcagatcctggcggagttccagctgcaggaggaggac
ctgaaaaaggtgatgaggcggatgcagaaggagatggaccgaggcctgaggctggagacc
cacgaagaggccagtgtgaagatgctgcccacctacgtacgctccaccccagaaggctca
gaggttggggacttcctctccctggacctgggcggcaccaacttcagggtgatgctggtg
aaggtgggggaaggcgaggaggggcagtggagtgtgaagaccaagcaccagatgtactcc
atccccgaggacgccatgaccggcactgctgagatgctctttgactacatctccgagtgc
atctccgacttcctggacaagcatcagatgaagcacaaaaagctgcccttgggcttcacc
ttctcctttcccgtgaggcacgaagacatcgacaagggcatccttctcaactggaccaag
ggcttcaaggcctcgggagcagaagggaacaacatcgtggggctcctgcgagatgccatc
aaacggagaggggactttgagatggacgtggtggcaatggtgaatgacactgtggccacg
atgatctcctgctactatgaagaccgccgatgtgaggttggcatgattgtgggcacgggc
tgcaacgcctgctacatggaggagatgcagaacgtggagctggtggaaggggacgagggc
cgcatgtgtgtcaacactgagtggggcgcctttggggactcgggagagctggacgagttc
ctgctggagtatgaccgcgtggtggacgagaactccctgaacccgggccagcagctgtac
gagaagctcatcggtggcaagtacatgggcgagctggtgcgactcgtgctgctgaagctc
gtggacgagaacctgcttttccacggggaggcctcggagcagctgcgcacgcgcggcgcc
ttcgagacgcgcttcgtgtcacaggtggagagcgactcgggcgaccgcaagcagatctac
aacatcctgagcacgctggggctgaggccctcggccaccgactgcgacatcgtgcgccgc
gcctgcgagagcgtgtccacgcgcgccgcgcacatgtgcgccgcggggctggcaggcgtc
atcaaccgcatgcgcgagagccgcagcgaggacgtgatgcgcatcaccgtgggcgtggac
ggctccgtgtacaagctgcaccccagcttcaaggagcggttccacgccagcgtgcgcagg
ctgacgcccagctgcgaaatcaccttcatcgagtcggaggagggcagcggccggggcgcg
gccttgatctccgcggtggcgtctaagaaggcctgcatgctgggccagtga

DBGET integrated database retrieval system