KEGG   Sus scrofa (pig): 100514295Help
Entry
100514295         CDS       T01009                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
ssc  Sus scrofa (pig)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:ssc03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ssc03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ssc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssc03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:ssc03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 270 aa AA seqDB search
MWNSGFESYSSSSFGGAGGYTQSPGGFGSPTPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFKIGNVEISQVTIVGIIRHAEKAATNIVYKIDDMTAAPMDVRQWVDTDDASGENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVVNAHMLLNKSNSQLLAGR
VPVSNPGMGEVGSFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLQHMSVA
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagtggatttgaaagctatagcagctcctcctttgggggagccggcggctac
acacagtcccctgggggctttggatcaccgacaccttcccaggctgaaaagaaatctaga
gcccgagctcagcacattgtaccctgtaccatatctcagctgctttctgctactctggtt
gatgaagtgttcaaaattgggaatgttgagatttcacaggtgactattgtggggataatc
agacatgcagagaaggctgcaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggatgtccgccagtgggttgacacagatgatgccagtggtgaaaacactgtggtt
cctccagaaacatatgtgaaagtagctggtcatctgagatcttttcagaacaagaaaagc
ctggtcgcttttaagatcatgcccctggaggatatgaatgaattcaccacacatattcta
gaagtagtcaatgcacacatgctgctgaacaagtctaacagccagctcctagcagggaga
gtacctgtcagcaatccaggaatgggtgaagttgggagctttggtgggaatagcttcatg
ccagcaaatggcctcactgtggcccagaaccaggtgctgaatttaattaaggcttgtccc
cggcctgaaggactgaactttcaggatctcaagaaccagctccaacacatgagtgtagcc
tcgatcaagcaagctgtggattttctaagcaacgagggacacatctattcaactgtggat
gatgatcattttaaatccacagatgcagaataa

DBGET integrated database retrieval system