KEGG   Sus scrofa (pig): 100514437Help
Entry
100514437         CDS       T01009                                 

Gene name
MYL7
Definition
(RefSeq) myosin regulatory light chain 2, atrial isoform
  KO
K12754  
myosin regulatory light chain 7
Organism
ssc  Sus scrofa (pig)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100514437 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100514437 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100514437 (MYL7)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100514437 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
18
AA seq 175 aa AA seqDB search
MASRKAGTRSKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVNVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRLFDPSGKG
VVNKDQFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagaaaggcggggacccggagcaaggccgcggccaccaagcaggcccagcga
ggctcttccaatgtcttttccatgttcgagcaagcccagatccaagagttcaaggaagcc
ttcagctgcatcgaccagaaccgtgatggcatcatctgcaagtcagaccttcgagagacc
tactcccagctggggaaggtgaatgttccagaagaggagctggatgccatgctgcaggaa
gggaaggggcccatcaacttcaccgtcttcctcacgttgttcggggagaagctcaacggg
acagaccccgaagaagccatcctgagcgccttccgcctgtttgaccccagcggcaagggc
gtggtgaacaaggaccagttcaagcagcttctcctgacccaggcagacaagttctctccg
gccgaggtggagcagatgttcgccctgacgcccatggacctggccgggaacattgactac
aagtccctgtgctacattatcacccacggggacgagaaagaggagtga

DBGET integrated database retrieval system