KEGG   Sus scrofa (pig): 100514437Help
Entry
100514437         CDS       T01009                                 

Gene name
MYL7
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
ssc  Sus scrofa (pig)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100514437 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    100514437 (MYL7)
   04530 Tight junction
    100514437 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100514437 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 175 aa AA seqDB search
MASRKAGTRSKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVNVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRLFDPSGKG
VVNKDQFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagaaaggcggggacccggagcaaggccgcggccaccaagcaggcccagcga
ggctcttccaatgtcttttccatgttcgagcaagcccagatccaagagttcaaggaagcc
ttcagctgcatcgaccagaaccgtgatggcatcatctgcaagtcagaccttcgagagacc
tactcccagctggggaaggtgaatgttccagaagaggagctggatgccatgctgcaggaa
gggaaggggcccatcaacttcaccgtcttcctcacgttgttcggggagaagctcaacggg
acagaccccgaagaagccatcctgagcgccttccgcctgtttgaccccagcggcaagggc
gtggtgaacaaggaccagttcaagcagcttctcctgacccaggcagacaagttctctccg
gccgaggtggagcagatgttcgccctgacgcccatggacctggccgggaacattgactac
aagtccctgtgctacattatcacccacggggacgagaaagaggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system