KEGG   Sus scrofa (pig): 100514462Help
Entry
100514462         CDS       T01009                                 

Gene name
USP10
Definition
(RefSeq) ubiquitin specific peptidase 10
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100514462 (USP10)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100514462 (USP10)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100514462 (USP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 360 aa AA seqDB search
MYHLMKFIPVFSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKVMRDIRPGAA
FEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKLLSPDNEKLTVSNG
PQSHLVDEDEQEEPGEGSEDEWEQVGPRNKTSVTRQADFVQTPITGIFGGHIRSVVYQQS
SKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRVTLEKL
PPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVV
YHHGSSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPAAERTAYLLYYRRVDLL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacctgatgaagttcatccccgtgttctccaaggtgcagcggccgtgcacgtcc
acccccatgatagatagctttgttcggctaatgaatgagtttaccaatatgccagtacct
ccaaaaccccggcaagcgctcggggataaggtcatgcgggacatccgccccggagctgcc
ttcgaacccacgtacatttacagactcctgaccgtcatcaagtcgagcctgtctgagaag
ggtcggcaggaggacgcggaggagtacctgggcttcatcctgaatggcctccacgaggag
atgctgagcctcaagaagcttctctccccggacaatgaaaaacttactgtttccaacgga
ccccaaagccacctggtggacgaagacgagcaggaagaaccaggcgaaggaagtgaggac
gaatgggagcaagtgggccccagaaataagacctcggtcactcgccaggcggattttgtt
cagaccccaatcactggcatttttggtggacacatcaggtccgtggtgtaccagcagagc
tccaaggagtctgccaccctgcagcccttcttcacgctgcagctggacatccagtccgac
aagatccgcaccgtccaggacgcgttggagagcctggtggcaagagagtctgtccagggc
tacaccaccaaaaccaagcaggaggttgagatcagtcgaagagtgactctggaaaaactg
cctcctgtcctcgtgctgcacctaaaacggtttgtctacgagaagactggtggatgccag
aagcttatcaaaaatatcgagtatcctgtggacttggaaattagtaaagaactgctttct
ccaggggttaaaaataagaattttaaatgccacagaacctataggctatttgcagtggtc
taccaccacggcagcagcgccacgggcggccactacaccacggacgtcttccagatcggc
ctcaacggctggctgcgcatcgacgaccagacggtcaaggtgatcaaccagtaccaggtg
gtgaagcccgccgcggagcgcacagcctacctcctctattaccgccgcgtggacctgctg
tag

DBGET integrated database retrieval system