KEGG   Sus scrofa (pig): 100514462Help
Entry
100514462         CDS       T01009                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 481 aa AA seqDB search
MGKPTVRVFPPARTLEQAAHLGAGLVEPPVPVPRGRGLRPAVFTGSRRHGPPPQPERQFR
RALGLPHLAVDSSLCFFALAELLENVTLIHKPVSLQPRGLINKGNWCYINATLQALVACP
PMYHLMKFIPVFSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKVMRDIRPGA
AFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKLLSPDNEKLTVSN
GPQSHLVDEDEQEEPGEGSEDEWEQVGPRNKTSVTRQADFVQTPITGIFGGHIRSVVYQQ
SSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRVTLEK
LPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAV
VYHHGSSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPAAERTAYLLYYRRVDL
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggggaagccgactgtcagggtgtttccacctgcccggaccctcgagcaggcggctcac
ctgggggcggggcttgtcgagccgccggttccggtcccgcggggccgaggtctgagacct
gccgtcttcacgggctcccggcgacacgggcccccacctcagcctgagcggcagttccgt
cgggccttagggcttccgcatctggccgtcgactcttcactgtgcttctttgctcttgca
gagttactggagaacgtgaccctgattcataaaccagtgtccttgcaaccccgcgggctg
atcaataaaggaaactggtgctacattaatgctacgctgcaggccttggttgcctgccct
ccgatgtatcacctgatgaagttcatccccgtgttctccaaggtgcagcggccgtgcacg
tccacccccatgatagatagctttgttcggctaatgaatgagtttaccaatatgccagta
cctccaaaaccccggcaagcgctcggggataaggtcatgcgggacatccgccccggagct
gccttcgaacccacgtacatttacagactcctgaccgtcatcaagtcgagcctgtctgag
aagggtcggcaggaggacgcggaggagtacctgggcttcatcctgaatggcctccacgag
gagatgctgagcctcaagaagcttctctccccggacaatgaaaaacttactgtttccaac
ggaccccaaagccacctggtggacgaagacgagcaggaagaaccaggcgaaggaagtgag
gacgaatgggagcaagtgggccccagaaataagacctcggtcactcgccaggcggatttt
gttcagaccccaatcactggcatttttggtggacacatcaggtccgtggtgtaccagcag
agctccaaggagtctgccaccctgcagcccttcttcacgctgcagctggacatccagtcc
gacaagatccgcaccgtccaggacgcgttggagagcctggtggcaagagagtctgtccag
ggctacaccaccaaaaccaagcaggaggttgagatcagtcgaagagtgactctggaaaaa
ctgcctcctgtcctcgtgctgcacctaaaacggtttgtctacgagaagactggtggatgc
cagaagcttatcaaaaatatcgagtatcctgtggacttggaaattagtaaagaactgctt
tctccaggggttaaaaataagaattttaaatgccacagaacctataggctatttgcagtg
gtctaccaccacggcagcagcgccacgggcggccactacaccacggacgtcttccagatc
ggcctcaacggctggctgcgcatcgacgaccagacggtcaaggtgatcaaccagtaccag
gtggtgaagcccgccgcggagcgcacagcctacctcctctattaccgccgcgtggacctg
ctgtag

DBGET integrated database retrieval system