KEGG   Sus scrofa (pig): 100514684Help
Entry
100514684         CDS       T01009                                 

Gene name
DYRK1A
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 764 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPAT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPIAWSGTDAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLS
SSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPT
YQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccgtca
ttttcattccatgctgctggccttcagatggctggacagatgccccattcacatcagtac
agtgaccgtcgccagccaaacataagtgaccaacaggtttctgccttatcttattctgac
cagattcagcaacctctaactaaccaggtgatgcctgatattgtcatgttacagaggcgg
atgccccaaaccttccgtgatccagctactgctcccctgagaaaactttctgttgacttg
atcaaaacatataagcatattaatgaggtttactatgcaaaaaagaaacgaagacatcaa
cagggccagggggacgattctagtcacaagaaggagaggaaggtttacaatgatggttat
gacgatgataactatgattacattgtaaaaaacggagaaaagtggatggatcgttacgaa
attgactccttgataggcaaaggttcctttggacaggttgtaaaggcatatgatcgagtg
gagcaagaatgggttgccattaaaataataaagaacaagaaggcttttctgaatcaggcc
cagatagaagtgcgacttcttgagctcatgaacaaacatgacactgaaatgaaatactat
atagtgcatttaaaacgccactttatgtttcgaaaccatctctgtttagtttttgaaatg
ctgtcctacaacctctatgacttgttgaggaacaccaattttcgaggtgtctctttgaac
ctaacacgaaagtttgcacagcagatgtgcactgcactgcttttccttgcgactccagaa
cttagtatcattcactgtgacctaaaacctgagaacatccttctttgtaaccccaaacgc
agtgcaatcaagattgttgactttggcagttcttgtcaattggggcagaggatataccag
tatatccagagtcgcttttatcggtctccagaggtgctactgggaatgccttatgacctt
gctatcgacatgtggtcccttgggtgtattttagttgaaatgcacactggagaacctctg
ttcagtggagccaatgaggtagatcagatgaataaaattgtggaagttctgggtattcca
cctgctcatattcttgaccaagcaccaaaagcaagaaagttctttgagaagttgccagat
ggcacttggaacttaaagaagaccaaagatggaaaacgggagtataaaccaccagcaacc
cgtaagcttcataacatcctcggagtagaaacaggagggcctggtgggcgtcgtgctggg
gaatcgggtcacacggtggctgactacttgaagttcaaagacctcatcttaaggatgctt
gactatgaccccaaaactcgaattcaaccttactatgccctgcagcacagttttttcaag
aagacagctgacgaaggtacaaacacaagcaacagtgtttccacgagtcccgccatggag
cagtcccagtcctcgggtaccacgtccagcacgtcgtccagctcaggtggatcgtcgggg
acgagcaacagtgggcgagccaggtcggacccaacgcaccagcatcggcacagcggtggg
cacttcacggccgccgtccaggccatggactgtgagacacacagtccccaggtgcgtcag
caatttcctgctcccattgcttggtcaggcactgatgctcctacacaagtcactgttgaa
actcatcccgttcaagaaacaacctttcatgtagcccctcaacagaatgcattgcatcat
caccacggaaacagttcccatcaccaccaccaccaccaccaccaccaccaccaccaccat
ggacaacaagccttgggtaaccggaccaggccaagggtctacaattctccaacaaatagc
tcctctacccaggattctatggaggttggccatagtcaccactccatgacatccctgtcc
tcctcaactacttcctcctcgacatcttcctcctctactggtaatcaaggcaaccaggcc
taccagaatcgcccagtggctgctaataccttggactttggacagaatggagctatggac
gttaacttaaccgtctactccaatccccgccaagagactggcatagctggacatccgaca
taccaattttctgctaatacaggtcctgcacattacatgactgaaggacatctgacaatg
aggcaaggggccgatagagaagagtcccccatgacaggagtttgtgtgcaacagagtcct
gtagctagctcgtga

DBGET integrated database retrieval system