KEGG   Sus scrofa (pig): 100514687Help
Entry
100514687         CDS       T01009                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ssc  Sus scrofa (pig)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100514687
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100514687
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100514687
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100514687
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100514687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 85 aa AA seqDB search
MSPTSLKITLRQLMEGSSKTLPEVLTMEYRLSQACIGGHDFHEGVRAVLIDKDQNPKWKP
ANLKEVTDEDLNNHFNSLGSNDLKF
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaacatccctgaagatcacactaaggcaactcatggaaggatcttcaaagacc
ttgccagaagtattaactatggaatatcggctcagtcaagcttgtataggaggccatgac
tttcatgaaggcgttagggcagttttaatagataaagaccagaatcccaagtggaaacca
gctaatctaaaagaagttactgatgaagatttgaataatcacttcaactctctgggaagt
aatgatttgaaattttga

DBGET integrated database retrieval system