KEGG   Sus scrofa (pig): 100514687Help
Entry
100514687         CDS       T01009                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial isoform X1
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00280  Valine, leucine and isoleucine degradation
ssc00410  beta-Alanine metabolism
ssc00640  Propanoate metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
Module
ssc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100514687 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100514687 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100514687 (HIBCH)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100514687 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 GlutR_dimer
Motif
Other DBs
NCBI-GeneID: 100514687
NCBI-ProteinID: XP_020931922
Position
15
AA seq 386 aa AA seqDB search
MGLWKVWSFTSRFNSSKRTNTILQHLTMSKHTDAAAEVLLERKGCAGVITLNRPKFLNAL
NLSMIQQIYPQLKKWEQDPETFLIIMKGAGEKAFCAGGDIRVISENTKTNPKMVQDFFRE
EYMLNNAIDSCLKPYIALIHGITMGGGVGLSVHGQFRVATEKSLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYTAGIATHFVDSEKLGMLEDDLLALNSPSKENI
ADVLETYHTKSKIDQDKSFILEEHMDKINSWFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLPEVLTMEYRLSQACIGGHDFHEGVRAVLIDKDQNPKWK
PANLKEVTDEDLNNHFNSLGSNDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggctgtggaaggtgtggagcttcacgtccaggtttaattcatccaaaaggactaat
accatactgcagcatttgacaatgtctaagcacacggatgcagcagcagaagtcctattg
gagagaaaaggttgtgcaggagtgataacactaaacagaccaaagttcctaaatgcactg
aatctgagtatgattcagcaaatctacccacagctaaagaagtgggaacaagatccagaa
acattcctgatcatcatgaagggagctggtgaaaaggctttctgtgctgggggtgatatc
agagtgatctcagaaaatacaaagacaaacccaaagatggttcaagattttttcagagag
gagtatatgctgaacaatgccattgattcttgcctgaaaccatatattgcacttattcat
ggaataacaatgggtgggggagttggtctctcagttcatgggcaattccgagtggctacc
gaaaagtctctttttgcaatgccagaaacagcaatagggctattccctgatgtgggtgga
ggttatttcttgccacgacttcaaggaaaactgggatacttccttgcgttaacaggtttc
agactgaaaggaagagatgtgtacacagcaggaattgctacacactttgtagattccgaa
aagttgggcatgttagaagatgatctgttagccctgaactctccttcaaaagaaaatatt
gcagatgtcttagaaacttaccacacaaagtccaagattgatcaagacaaatcttttatc
cttgaggaacacatggacaaaataaacagttggttctcagccaatactgtggaagagatt
attgaaaatttgcagcaagatggttcatcttttgccctagagcagttaaaggtaattaat
aaaatgtctccaacatccctgaagatcacactaaggcaactcatggaaggatcttcaaag
accttgccagaagtattaactatggaatatcggctcagtcaagcttgtataggaggccat
gactttcatgaaggcgttagggcagttttaatagataaagaccagaatcccaagtggaaa
ccagctaatctaaaagaagttactgatgaagatttgaataatcacttcaactctctggga
agtaatgatttgaaattttga

DBGET integrated database retrieval system