KEGG   Sus scrofa (pig): 100514687Help
Entry
100514687         CDS       T01009                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ssc  Sus scrofa (pig)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100514687 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100514687 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100514687 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100514687 (HIBCH)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100514687 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 386 aa AA seqDB search
MGLWKVWSFMSRFNSSKGTNTILQHLTMSKHTDAAAEVLLERKGCAGVITLNRPKFLNAL
NLSMIRQIYPQLKKWEQDPETFLIIMKGAGEKAFCAGGDIRVISENTKTNPKMVQDFFRE
EYMLNNAIDSCLKPYIALIHGITMGGGVGLSVHGQFRVATEKSLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYTAGIATHFVDSEKLGMLEDDLLALNSPSKENI
ADVLETYHTKSKIDQDKSFILEEHMDKINSWFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLPEVLTMEYRLSQACIGGHDFHEGVRAVLIDKDQNPKWK
PANLKEVTDEDLNNHFNSLGSNDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggctgtggaaggtgtggagcttcatgtccaggtttaattcatccaaagggactaat
accatactgcagcatttgacaatgtctaagcacacggatgcagcagcagaagtcctattg
gagagaaaaggttgtgcaggagtgataacactaaacagaccaaagttcctaaatgcactg
aatctgagtatgattcggcaaatctacccacagctaaagaagtgggaacaagatccagaa
acattcctgatcatcatgaagggagctggtgaaaaggctttctgtgctgggggtgatatc
agagtgatctcagaaaatacaaagacaaacccaaagatggttcaagattttttcagagag
gagtatatgctgaacaatgccattgattcttgcctgaaaccatatattgcacttattcat
ggaataacaatgggtgggggagttggtctctcagttcatgggcaattccgagtggctacc
gaaaagtctctttttgcaatgccagaaacagcaatagggctattccctgatgtgggtgga
ggttatttcttgccacgacttcaaggaaaactgggatacttccttgcgttaacaggtttc
agactgaaaggaagagatgtgtacacagcaggaattgctacacactttgtagattccgaa
aagttgggcatgttagaagatgatctgttagccctgaactctccttcaaaagaaaatatt
gcagatgtcttagaaacttaccacacaaagtccaagattgatcaagacaaatcttttatc
cttgaggaacacatggacaaaataaacagttggttctcagccaatactgtggaagagatt
attgaaaatttgcagcaagatggttcatcttttgccctagagcagttaaaggtaattaat
aaaatgtctccaacatccctgaagatcacactaaggcaactcatggaaggatcttcaaag
accttgccagaagtattaactatggaatatcggctcagtcaagcttgtataggaggccat
gactttcatgaaggcgttagggcagttttaatagataaagaccagaatcccaagtggaaa
ccagctaatctaaaagaagttactgatgaagatttgaataatcacttcaactctctggga
agtaatgatttgaaattttga

DBGET integrated database retrieval system