KEGG   Sus scrofa (pig): 100514782Help
Entry
100514782         CDS       T01009                                 

Gene name
GK2
Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssc00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ssc03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 553 aa AA seqDB search
MAAPKTTGVGPLVGAVVQGTNSTHFMVFNSKTAELLSHHQVELTQVFPKEGWVEQDPKLI
LQSVYECIERTCEKLEELHVDLSNIKAVGVSNQRETTVVWDRLTGEPLYNAVVWLDLRTQ
STVELLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVSQVQKAVREGRALFGTIDS
WLIWSMTGGAHGGIHCTDVTNASRTMLFNIHSLQWDKELCDFFEIPMGILPDVWSSSEIY
GLMKTGALEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYKLGKDQPVCYALEGSVAIAGAVIRWLRDNLGIIKTSEESEKLAKEVGTSYGCYF
IPAFSGLYAPYWEPTARGIICGLTQFTNKSHIAFAALEAICFQTREILDAMNRDCGIPLN
HLQVDGGMTTNKVLMQLQADILHIPVIRASMPETTALGAAMAAGAAHGVDVWSLKPEDLS
TVMMERFEPQIKATESEIRYSTWKKAVMKSMGWVTTQPPESSEPTLFSSLPLGFFIVSSM
ILLIGARYISGIP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccgaagaccacaggtgtggggccgttggtgggagcagtggtccagggtact
aactccactcattttatggttttcaattcaaaaacagcagaactccttagtcaccatcag
gtggaattaacacaagtgttcccaaaagaaggatgggtggaacaagaccccaagctcatt
cttcagtctgtgtatgaatgtatagagagaacatgcgagaaacttgaagaactgcacgtt
gacctctccaacataaaagccgtgggcgtcagcaatcagagggaaaccacggtcgtctgg
gacaggctcacgggggagccgctctacaacgccgtggtgtggctcgacctgagaacccag
tccaccgtggagctcctcagcaaaaaaattccagggaataataacttcgtcaagtccaag
acaggcctgcccctcagcacttacttcagtgcggtgaagcttcgctggcttcttgacaac
gtgagtcaagttcagaaggcggttcgagaaggcagagctctttttggtaccatcgattcc
tggcttatctggagcatgactggaggggctcacggaggcatccactgcacagatgtaaca
aatgcaagcaggacgatgctcttcaacatccactctctgcaatgggacaaagagctgtgc
gatttctttgaaattccaatgggcattcttccagacgtctggagctcttcggagatctat
ggcctaatgaaaaccggggccttggaaggcgtgcccatatcagggtgcttgggggaccag
tctgctgcattagtaggacaaatgtgcttccaggaaggacaagccaaaaacacatatgga
acaggctgtttcttactatgtaatacaggccacaagtgtgtattttcggagcatggcctg
ctgaccacggtggcttacaaactaggcaaagaccagccagtatgttatgcgctagaaggt
tctgtcgctatagctggtgctgttattcgctggctacgagacaaccttggaattataaag
acctccgaagaaagtgaaaaacttgctaaagaagtaggtacttcttacggctgctacttc
atcccagccttttcaggattatacgcaccttattgggagcccacggcaagagggataatc
tgtggtctcactcagttcaccaataaaagtcatattgctttcgctgcattagaagctatt
tgtttccaaacccgagagattttggatgccatgaaccgtgactgtggaattccacttaat
catctgcaagtagatggaggaatgaccaccaacaaagtccttatgcaactgcaagcagac
attctgcatattccagtaataagagcctctatgcccgaaacgactgcactgggagctgcc
atggcagcaggagccgcacatggggtggacgtctggagtcttaaacctgaggatctgtca
actgtcatgatggaacggtttgaaccacagatcaaggccacagaaagtgaaattcgttac
tctacatggaagaaagctgtgatgaagtcaatgggttgggttacaactcagcctcctgaa
agtagtgaacctaccctgttctctagtctgcccttgggtttttttatagttagcagcatg
atactgttaattggagcaagatacatctccggtataccataa

DBGET integrated database retrieval system