KEGG   Sus scrofa (pig): 100514805Help
Entry
100514805         CDS       T01009                                 

Gene name
KMT2C, MLL3
Definition
(RefSeq) histone-lysine N-methyltransferase 2C
  KO
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100514805 (KMT2C)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100514805 (KMT2C)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100514805 (KMT2C)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100514805 (KMT2C)
   HMT complexes
    MLL3/MLL4 complex
     100514805 (KMT2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
18
AA seq 3404 aa AA seqDB search
MNGLIAPGPHLPHNSLPAGSGLGTFPSVAPSPYADARDKNPAFNPMASDPNGSWTSSAPT
MEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNVNFPNLKEEFPDWTTRVKQIAKL
WRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSDLFKDPLK
QRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQQQQFGPQPLLGQSG
SDTPSSGIQSPLTPQPGNGSISPAQSFHKDLFTKQPPSTPASASSDDVFVKPQAPPPPPA
PSRVSIPESLSQSQTSQPPSPQVFSPGSSNPRPPSPVDPYAKMVGTPRPPPGGHGFSRRN
SALVETSAPLSSVSRPMSETPASRPSPVRDVCSSSAANSDPYAKPPDTPRPVMADPFPKP
LGLPRSPIVSEQTAKGPLAAGANDHFTKPSPRADAFQRQRIPDPYGRPLLTPAPLDSGSG
PFKTPMQPPPSSQDPYGSVSQAPRRLPMDPYERPALTPRPVDNFSHNQSGDPYSQPPLTP
HPAMNESFTHPSRAFPQPGTMSRLASQDPYSQPPGTPRPVVNSYSQPSGTSRSNPDPYSQ
PPGTPRPAAIDPYSQQPPTPRPPAQADLLVPPAANQRHSDPYAHPPGTPRPGISVPYSQP
PATPRPRVSEGFTRSSVTRPVLMPNQDPFLQAAQNRGQALPGPLVRPPDACSQAARPPGP
GLSDAFSRVSPSAPRDPYEQPPMTPRSQSDSLGPSQVTHDVADQPRPGSEGALGAPSNSP
VNSQGHQFPAVSQLPGPAPTSGVTDTQNTVNMSQADTEKLRQRQKLREIILHQQQKKMAG
RQEKASQDPGAAPPPAPLQHWQPESIGPAFTRPPPPYPGSIRSPVVAPLGPRYTVFPKDP
RGPYPPDVTGVGMRPQGFRFGFPGGSHGRLSSQERFLMPPQQIQGSGVPPQLRRSMSVDM
TRPLNNSQMNNPVGLPQHFPPQSLPVQQHNILGQAFIELRHRAPDGRPRMPFTASPGNMI
EAPSHPRHGSFVPRPDFPGPRHTDPMRRPSQALPHQLPVHPNLEQVPPAPQEQSHPVHSS
SVLMRSLSHPLGGEFPEAPLSASAPAEAAPDNLQITAQSSDGLEEKLDSDDPSVKELDVK
DLEGVEVKDLDDEDLENLNLDTEDGKGDELDTLGNLETNDPNLDDLLKSGEFDIIAYTDP
ELDLGDKKSMFNEELDLSVPIDDKLDSQCVSLEPPKKEQEDKTVVPSDKPSPWKKSTVTS
EIKTEVLSPNSKGETNCESEKSEACRDHVDAPCPGASAHTATNDGEKASLQSCDTELLEK
RADGDTAGSNTAGGHGPAHLPAEDVINPCGITGSTPVLSSLLANEKSDNSDTRPLGSPPP
TLPASPSSHVSSLPPPLMTPPGHGLDNTMNSNVTAVPRLNHTFPPGMQVNPGFLQGQSPV
NHAFGTGKPTNQTVPLTSQSGTGGMSGPQQLMIPQTLAQQNRERPLLLEEQPLLLQDLLD
QERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNMGMPP
MVMNRFPFMGPSVPGTHPGEGQNVLPQTVTQDGSITHQISRPNPPNFGPGFVNDSQREQY
EEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQ
QSMVQKQLEQIRKQQKEHAELIEEYRIKQQQQQQQQRAMAPPTVMPGVPPQPPLVPGAPP
PSMSQPSFPLVPPQLQHQQHTAAISGHTSPARMPSLPGWQSANAPSHLPLNPPRIPPPVA
QLPIKACTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLM
QEVDRQRALQQRMEMEQHSMMGPELSGRTPVSQIPFYGSDLPCDFMQPPRPLQQSPQHQQ
PMGQVLQQQNIQQGSVNSPPTQNFMQTNERRQIGPPSFVPDSPSVPGGSPNFHAVKQVHG
GLPGASFQPSPARPPFTPALPPAPPVASNSLPCGQEPAVTHGQSYPGSAQSLIQLYSDII
PEEKGKKKRTRKKKKDDDAESAKAPSTPHSDITAPPTPNVSETTSTPTVNTPSELPQQAD
PEPAEPGGPSTPDTAAGPLCAEPENKLPGSDFSQQTYASPEVDKLPIETPASIKEIKLET
AEREPSPGQDGAEAEERPGGQAQEKAAAGAAPTGQSPPRPAGTPAAKGDSGNELLKHLLK
NKKASSLLNQKPEGGFCSEDDCAKDNKLTERQNPAEVPTLGAQMQGGFGCGNNQLPKTDG
GSETKKQRSKRTQRTGEKAAPRSKKRKKEEEEKQAMYSSTETFTHLKQQLSLLPLMEPVI
GVNFAHFLPYGSGPFNSGNRLLGAFGSATLEGVSDYYSQLIYKQNNLSNPPTPPASLPPT
PPPMACQKMANGFATTEELAGKAGVLVSQEVTKSLGPKPFQLPFRPQDDLLARAIAQGPK
TVDVPASLPTPPHNNQEELRIQDHGGGRDTPDSFVPSSSPESVVGMEVSRYPDLSLVKEE
PPEPVPSPIIPILPSHPGKGLESRRNDIKTEPGTLFFTSPFGSSPNGPRSGLISVAITLH
PTAAENISSVVAAFSDLLHVRIPNSYEVSNAPDGPSVGVVSSHRVNPGLEYRQRLFLRGP
PPGPANPPRLASSYHLKQPNVPFPPASNGLSGYKDASHGIAESAALRPQWCCHCKVVILG
SGVRKSVRDLAFVNKDFRESSSRVEKDIVFCSNNCFVLYSSAAQAKNSESKDCMASLPQS
PVREPPSRAFHQYSTNISTLDVRCLPQFQEAASPPASPPITFPPAFEAAQVEAKPDELKV
TVKLKPRLRTVHGGLEDCRPSAKKWRGMKWKKWSVHIVVPKGAFRPPCEEEIDEFLKKLG
TSLKPDPVPRDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGAL
INVELALRRGLQMKCVFCHKMGATSGCHRFRCTNSYHFTCAVKAQCMFFRDKTTLCPMHK
PKGVHEQELSSFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQ
AFHSAKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEHGHEDLVLSD
TSPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENY
TFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELN
APYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRN
EVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHK
IIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
NT seq 10215 nt NT seq  +upstreamnt  +downstreamnt
atgaatggccttattgcacccggtcctcacctcccacataactctctgcctgctggaagc
ggattgggaaccttcccttctgtcgcaccatctccctacgctgatgccagggataaaaat
ccagcctttaatccaatggcaagtgatcctaacggctcttggacatcctcggcgcccacc
atggaaggagaaaatgatacaatgtcaaacgcccagaggagcacactcaagtgggagaag
gaggaggccctgggcgaaatggcaacggtggcccccgtgctctacactaatgttaatttc
cccaacctcaaggaggagttccccgactggactacgcgagtgaagcagatcgccaagttg
tggagaaaagcaagctcgcaggaaagagcaccatacgtgcaaaaagccagagataacaga
gctgctttacgaattaataaagtacagatgtcaaatgattccatgaagaggcagcagcag
caagacagcatcgatcccagctcgcgtattgattcagatcttttcaaagatccactaaag
caaagagaatcggaacatgaacaggaatggaaattcagacagcaaatgcgtcagaagagt
aagcagcaggccaaaattgaagccactcagaaactggagcaggtgaagaatgagcagcag
cagcagcagcaacagcagcagcagcagtttggccctcagcctctcctgggtcagtctggc
tcggacacaccgagcagtgggatacagagccccttgaccccccagcctggcaatggaagt
atatctcctgcacagtcattccataaagacctgtttacaaagcagccgcccagcacccct
gcctctgcatcatcagatgatgtgtttgtaaagccgcaagccccccctcctccccccgcg
ccatcccgggtttccatcccagagagtctgtcccagtcccagacttctcagccaccttcc
ccacaggtgttctcacctggatcttctaacccccggccaccatctccagtggacccttat
gcgaaaatggttggtaccccaagaccacctcctgggggccatggcttttccagaagaaat
tccgcgttggtggaaacctctgcacctttatcatcagtgtctcggcccatgagcgagacg
ccagcgagtcggccatccccagtcagagatgtgtgctcttcctccgcagcaaacagtgac
ccctatgcaaagcctccagacacgcctcggcctgtgatggcagatccgtttcccaagccc
ttgggcctaccccggtctcctatagtttctgaacaaactgcaaaaggccctcttgcagct
ggagccaatgaccacttcactaaaccatctcccagggcagatgcatttcaaagacaaagg
atacctgacccctatgggcgacccttgttgacacctgcacctcttgatagtggttctgga
ccttttaaaactcccatgcagccccctccatcctcccaggatccttatggatcagtgtca
caggcaccaaggcgattgcctatggacccttatgaaaggcctgctttgacgccacgacct
gtagataacttttctcacaaccagtcaggtgatccgtatagccagcctcccctaacccca
catccggcaatgaatgaatctttcacccatccttcaagggctttcccccagcctggaacc
atgtcaaggctcgcatctcaggatccgtactcccaacctccaggaactccacgtcctgtt
gttaattcttactcccaaccctcaggaacatctcgatccaacccagacccttactctcaa
cctcctggaactccccggcccgccgccattgatccgtatagtcagcagccaccaacccca
aggccgcctgcacaagcagacttgttggttccacctgcagcgaaccagaggcattcggat
ccatatgctcatcctcctggaacaccaagacctggaatttctgttccttactctcaacca
ccagcaacaccaaggccaagggtttcagagggttttactaggtcttcagtgacaagacca
gtcctcatgccaaatcaggaccctttcctgcaggcagcacagaatcgaggacaagcttta
cctggccccttggtacggccccctgatgcgtgttcccaagcagctaggccacccggacct
ggcctttcagacgcgttcagccgtgtttccccatctgctccccgtgatccctatgagcag
ccgcccatgactccaagatctcagtctgactctctgggaccgagtcaggtcactcacgat
gttgctgatcagccgcggcctggatcagagggggccttgggtgcaccttccaactctcca
gtgaattctcaaggccaccagttccctgctgtctcccaactccctggacctgcaccgacc
tcgggagtcaccgatacacagaatactgtaaatatgtctcaagctgataccgagaaattg
agacagcgacagaagttacgtgaaatcatcctccaccagcagcagaagaagatggcaggt
cggcaggagaaggcctcccaggatccaggagcagcgcctcccccggcccccctgcagcac
tggcagccggagagcatcgggcccgctttcactaggcctccgcccccctatcccgggagc
atcaggtcacccgttgttgctcctctgggaccgagatacacagttttccccaaagacccc
cgtggaccctatcctcctgatgttactggagtgggaatgaggcctcagggatttagattt
ggatttccaggaggaagtcatggtcgcttgtcaagtcaggaacgcttccttatgcctcct
cagcaaatacaggggtctggagttcctccccagctgagaaggtcaatgtctgtcgatatg
actaggcctctaaataactcacagatgaataacccagttggacttcctcagcattttcca
ccacagagcctgccagttcagcagcataacatactgggccaagcatttatcgagttgagg
cacagggcccccgatggaaggccacggatgcccttcaccgcctctccaggcaacatgata
gaggcaccttcccatccgagacatgggagcttcgttccccgaccagacttcccaggccca
agacacacagacccaatgagacggccttcccaagctctccctcatcagctgcctgtgcat
cccaatttggaacaagtgccaccagctccgcaagagcaaagccatcccgtccactcgtct
tctgtgctcatgaggtctctgagtcatcccttgggaggtgaatttccggaggcccctctg
tcagcgtctgcaccagctgaagcggcgcctgataatttgcagataaccgcccagtcttcc
gacggtctcgaggaaaagctggactctgatgacccctcagttaaagaactggatgttaaa
gacctcgagggggttgaagtcaaagacttggatgatgaagaccttgaaaatttaaatcta
gatacagaggatggcaagggcgatgaattagataccttaggtaatttggaaactaacgat
cctaacctggacgacctcttaaagtctggagaatttgacatcattgcgtacacagatccg
gaactggacttgggagataagaaaagcatgtttaacgaggaactcgacctcagtgttcca
atcgatgataagttagatagtcagtgtgtatctcttgaaccccccaaaaaggagcaagaa
gacaaaactgtggttccttccgataagccttctccttggaaaaaatccactgtcaccagt
gagataaaaacggaagtactgtctccaaattctaaaggggaaaccaactgtgaaagtgag
aaaagtgaagcgtgtagagaccacgtggacgccccctgccccggggcctctgctcacaca
gccacaaatgatggggagaaagcttccttgcagtcttgtgatacggagctccttgagaag
agggccgacggagacaccgctggctccaacacagctggtggtcatgggcctgctcacttg
cctgccgaagatgtgataaacccttgcgggataacgggatcgactccagttctctcaagt
ttactcgctaatgagaaatctgataactcagacacgaggccgttggggtctccacctcca
actctgccggcctcaccatccagtcatgtgtcaagtttgcctcctcccctcatgacacca
cctggtcatggtctggataacaccatgaattccaatgtgacggcggtccctagattaaac
cacactttccctccgggtatgcaggtaaacccgggattcctccagggccagtcaccagta
aaccacgcttttggaacaggaaaacctacaaatcagactgtccctctgacaagtcagtct
ggtaccggcggcatgtcgggaccccagcagctaatgattcctcagacgttagcccagcag
aatagagagaggcccctccttctggaggagcagcctctccttctgcaggatcttctggac
caggagcggcaggaacaacagcagcagagacagatgcaagccatgatccgtcagcggtcg
gaaccattcttccccaacatcgattttgatgcaattacagatcctataatgaaagccaaa
atggtggctcttaaaggcataaataaagtaatggcacaaaacaatatgggcatgccgccg
atggttatgaacaggttccccttcatgggcccgtcggtgcctggcacacaccctggtgaa
gggcagaatgtcctgccccagacagtgacgcaggatggcagtataacacatcagatttct
aggcctaatcctccaaattttggtccaggctttgtcaatgattcacagcgtgagcagtat
gaagaatggcttcaggagacccagcagcttcttcagatgcagcagaaataccttgaagaa
caaattggtgcacacagaaaatctaagaaggccctttcggctaaacagcgcactgccaag
aaagccgggcgtgagtttccagaagaggatgcagaacaactcaagcacgttactgaacag
cagagcatggttcagaaacagttggagcagattcgtaagcagcagaaggagcatgccgag
ctgattgaggagtatcggatcaagcagcagcagcagcagcagcagcagcgagcaatggcc
ccacccactgtcatgccaggcgtcccaccccagccgcccctagttccaggcgcacccccc
ccttccatgagccagcccagctttcccttggtgccaccacagctgcagcaccaacagcac
acagcagctatttctggccacaccagccctgccagaatgcccagtttacctggatggcag
tctgccaatgctccttctcacctccccctcaatcctcctaggattccgcctccagttgcc
cagttaccaataaaagcttgcacaccagccccagggaccgtgtcaaatgcaaatccacag
agtggacccccaccacgggtggaatttgatgacaacaaccccttcagtgaaagttttcaa
gaacgagaacgcaaggaacgtttacgggaacagcaggaaagacagcgcatccagctcatg
caggaagtagacagacagagagctttgcagcagaggatggaaatggagcagcacagcatg
atgggccctgagctcagtggtaggactcctgtgtcccagatcccattctacggttctgac
ctgccttgtgattttatgcaacctccaaggcccctccagcagtctccgcagcaccaacag
ccaatggggcaggttttacagcagcagaatatacagcagggatctgttaactcacctccc
acccaaaatttcatgcaaaccaacgagcgaaggcagataggacctccctcctttgttccc
gattctccatcagttcccggtggcagcccgaacttccacgctgtgaagcaggtccacggc
ggtcttcccggggccagcttccagccgtcccccgcgaggcctccttttacacctgcttta
cccccagcacctccagtggcttctaacagccttccgtgtggccaagagcctgccgtgacc
catggacagagttacccgggatccgcccagtccctcattcagctgtactctgatatcatc
ccagaggagaaggggaagaagaaaagaacgaggaagaagaagaaggacgatgatgcggag
tctgccaaggctccctccaccccccattcggatataactgccccgccgacgccgaacgtc
tccgaaactacctccacgcccacggtgaacacgcccagcgagcttcctcagcaagcagac
cccgagccggcggaaccaggcggcccgtcgactcctgacacggcagcaggcccgctgtgt
gcggagccagagaacaagctgcccggcagtgacttctcacagcagacctatgcaagtcca
gaggtggataagctccccatcgaaacccctgcttccatcaaagagattaaactggagacg
gcggagcgggagccaagccccggccaagacggagctgaggcggaggagcgccctgggggt
caggcccaggagaaggctgcagccggagccgcccccacggggcagagcccaccccgacct
gcagggacccccgctgccaaaggcgattcgggcaatgagcttctgaagcacctgctgaaa
aataaaaaggcatcttcccttctaaatcagaagcccgaaggtggattttgctcagaagat
gactgtgcgaaggataacaaactaactgagaggcagaacccagccgaagtgccaactttg
ggggctcaaatgcaaggtggttttggatgtggtaacaaccagttgccaaaaacagacgga
ggaagtgaaaccaagaagcagcgaagcaaacggacgcagaggactggggagaaggcagca
cctcggtcaaagaaaaggaaaaaggaagaagaggagaaacaagctatgtactcttccact
gagacctttacgcacctgaaacagcagctctctctgctccctctaatggaaccagtcatt
ggagtgaactttgcccactttcttccttacggcagtggcccgtttaatagtgggaatcga
cttctaggagcttttggcagtgctacccttgaaggggtttcggattactattctcagttg
atctacaagcagaataatttaagtaatcctccaacaccccctgcctctcttcctcctaca
ccacctcctatggcttgtcagaagatggcaaatggttttgcgacaactgaagagctggct
ggaaaagctggagtgttagtgagccaagaagttaccaaaagtctgggacctaaaccattt
cagctgccgttcagaccacaggatgacttgttagccagagcgattgctcaaggcccaaag
acagtggatgttccagcttcactcccaacaccacctcataacaatcaggaggaattaagg
atccaggaccacggtggtggtcgggacacccctgacagctttgttccttcatcctctccg
gagagcgtggtcgggatggaagtcagcaggtacccggatctgtcactggtcaaagaggag
cctccggagccggtgccatcccccatcatcccgatccttcccagccatcccgggaaaggt
ttggaatctagaaggaatgacatcaaaactgaaccaggcactttatttttcacatcaccg
tttggttcctccccaaatggtcccagatcgggtctcatatctgtggcaattactctgcat
ccgacagctgctgagaacattagcagtgttgtggctgcgttttccgaccttctccacgtc
cgaattcctaacagctatgaggttagtaatgccccagatggtccatccgtgggtgtggtc
agtagccacagagtaaacccaggtttggagtatcgacagcgcttatttcttcgtgggcct
ccaccaggacctgcaaaccctcccagattagccagctcttaccacctgaagcagcctaat
gtgccttttcctccagcgagcaacggtctttctggatacaaggatgctagtcatggcatt
gcagaaagtgcggccctcagaccacagtggtgctgccactgcaaagtggttattctgggc
agcggcgtgaggaagtcggtcagagacctggcctttgtgaacaaggatttccgagaaagc
tccagtagggtggaaaaggacattgtcttctgcagtaacaactgctttgttctctattca
tcagctgcccaagcaaaaaactcggagagcaaggactgcatggcttcgttgccacagtca
ccggtcagagagccaccttccagagctttccatcagtacagcaccaacatctccactttg
gatgtgcgttgcctgccgcagttccaggaggcagcttcgccccccgcgtcgcctcccatc
acgttccctcctgcttttgaagccgcccaggtcgaggcaaagcccgatgagctgaaagtc
accgtcaagttaaagcctcggctgaggaccgtccacggcggcttggaggactgccggccg
agcgctaagaagtggcggggcatgaagtggaagaagtggagcgtccacatcgtggtcccc
aagggggcgttccgacccccctgcgaggaggagatcgatgagtttctgaagaaactgggc
acgtccctgaagcccgatcctgtgcccagagactatcggaagtgctgcttctgccacgaa
gaaggcgacggcctgacagacgggccggcccggctgctcaacctcgacttggacctgtgg
gtgcacctgaactgcgcgctgtggtccaccgaggtctacgagacccaggctggcgcctta
atcaacgtcgagctcgccctcaggcgcggcctgcagatgaagtgtgtcttctgccacaag
atgggggccaccagcgggtgccaccgatttcgatgcaccaacagttaccacttcacctgc
gccgtgaaagctcagtgcatgttcttccgagacaaaaccacgctgtgccccatgcataag
ccaaagggggtccacgagcaggagctgagctccttcgccgtcttcaggagggtctacgtg
cagcgcgacgaggtgcggcagatcgccagcatcgtgcagcggggggagcgcgaccacacc
ttccgggtgggcagcctcatcttccacaccatcggccagctgctcccgcagcagatgcag
gccttccactcggccaaggcgctcttccccgtgggctacgaggccagccggctctactgg
agcacgcgctacgccaaccggcgctgccgctacctgtgctccatcgaggagaaggacggg
cgccccgtgttcgtgatcaggatcgtggagcacggccacgaagaccttgtcctgagcgac
acgtcgccgaaaggtgtctgggataaaattttggagcctgtggcatgtgtgagaaaaaaa
tctgaaatgctccagcttttcccagcctatttaaaaggagaggacctgttcggcctgacg
gtctctgcagtggcgcggatcgccgaatcactccctggggttgaggcgtgtgaaaactac
accttccggtacggccgcaacccgctcatggagcttcctcttgccgtcaaccccacaggt
tgtgcccgttctgaacctaaaatgagtgcccatgtcaagaggtttgtgttaaggcctcac
accctgaacagcaccagcacgtccaagtccttccagagcacagtcaccggggagctgaac
gcgccctacagcaagcagtttgtccactccaagtcgtcccagtaccgcaagatgaaaacc
gagtggaagtcgaacgtgtacctggcccggtctcggattcaggggctgggcctctacgct
gcgcgggacatcgagaagcacaccatggtgatcgagtacatcgggaccatcatccggaac
gaggtcgccaacaggaaggagaagctctacgagtcgcagaaccgaggcgtgtacatgttc
cgcatggacaacgaccacgtcatcgacgccacgctcacaggagggcctgcgaggtacatc
aaccattcatgtgcacctaactgtgtggctgaagtggtgactttcgagagaggacacaaa
atcatcatcagctccagtcggagaatccagaaaggagaggagctttgctatgactataag
tttgactttgaggacgaccagcacaagatcccctgtcactgtggcgccgtgaactgccgg
aagtggatgaactga

DBGET integrated database retrieval system