KEGG   Sus scrofa (pig): 100515275Help
Entry
100515275         CDS       T01009                                 

Gene name
USP36
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 36
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100515275 (USP36)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100515275 (USP36)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100515275 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
12
AA seq 1107 aa AA seqDB search
MPIVDKLKEALKPGRRDSADDGELGRLLASSAKKVLLQKLEFEPASKSFSYQLESLKSKY
VLLNPRPEGAGCPKSGGGELASDGDGDGVPAPQKVLFPGERLSLRWGRVYRVGAGLHNLG
NTCFLNSTVQCLTYTPPLANYLLSREHTRGCHQGSFCMLCVMQNHIVQAFANSGNAIKPV
SFIRDLRKIARHFRFGNQEDAHEFLRYTIDAMQKACLSGCAKLDRQTQATTLVHQIFGGY
LRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVLSGENAYMCAKCKKK
VPASKRFTIHRTSNVLTLSLKRFANFSGGKITKEVGYPEFLNIRPYMSQSNGEPVLYGLY
AVLVHSGYSCHAGHYYCYVKASSGQWYQMNDSLVHASNIKVVLNQQAYVLFYLRIPGSKK
SPQGSISRTASSLPGCPGAALDHVKKSVSNGPASSPPAGKRPDPAMMKKPQTPEELGVPV
ARNGSVSGLKPQNGYAPPKPPVGSPSPKLSKTPTHAPTLLEEPGKKVKKPAPPPPLSPPP
RPSQGPRGAGEPGGSRGEGRGPGPWGGKASLSPSPRPLAPGTANGLGPQAGDGGSAAERR
GSGGSSPERSAGSGPARNPQAPQGGSTHLCESQGTPSRGPPAQEDARLAKAKCPILSGAA
PEPANTMSPPPAKKLALSAKKASTLRRAASSDLRPPPLSPSSDLTHPRKPAHPAAASTWP
RSTIRAVSPAPRPSSHLKPPLGPRPPSLPSSPQPLRTSDPQSCSSASAPLPQVNGGFQAP
PHQPPEASEPPXSPCKKKRKPCMAETEDQGCETCTAAAAPPGKRRRRKRKHTGDVAASSP
APQEGLLQGQPWSPKRRKEGRPEPPADRWEEEGGQQQGKRWRLGSSGWPGGCVSDSHQVN
SRKRRRKGAEGLGGEALARDPPRRGNCSLSDAVLPETTAASPRKKKKKKRKEESQQHTDE
NQSTGQRGRSAAVPGSLLLLAMNGQGPGEPTGLGQTPLVSWDGEKESDVVQELLKYSSDK
AYGRRVLTWDGEVSAVSRDAVQDSRLARAATVIDDWDEAFDRGKEKKVKKFKREKKRNFN
AFQKLQSRRNFWSVTHPAKAASLSHRR
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atgcccatagtggacaagctgaaggaagccctcaagccgggccgcagggactcggctgac
gatggggagctggggaggcttctggcctcctccgccaagaaggtccttctgcagaagctg
gagttcgagccggccagcaagagtttctcctaccagctggagtcgctgaaaagcaaatat
gtgctgctgaacccccggccggagggagccggctgccccaagagtgggggtggcgagctc
gcatccgacggggatggggacggggtccccgcgccccagaaggtgctcttccccggagag
cggctgtccctgcgctggggacgcgtctaccgcgtgggcgcagggctgcacaacctcggc
aacacctgcttcctcaactccaccgtgcagtgcttgacctacacgccacccctggccaac
tacctgctctccagggagcacactcggggctgtcaccagggcagcttctgcatgctgtgc
gtgatgcagaaccacatcgtccaggccttcgccaacagcggcaacgccatcaagcccgtg
tccttcatccgggacctgaggaagatcgcccggcatttccgctttgggaaccaggaggac
gcgcacgagtttctgcgctacaccatcgatgccatgcagaaggcctgcctgagcggctgt
gccaagttggatcgtcagacgcaggctacaactttggtccatcagatctttggaggctat
ctcagatcgcgggtgaagtgctccgtgtgcaagagcgtctcggacacctacgacccctac
ttggatgtggccctggagatccggcaagccgcgaacatcgtgcgtgctctggagctgttc
gtgaaaccagatgtcctaagtggcgagaacgcctacatgtgcgcaaaatgcaagaagaag
gttccagccagcaagcgcttcaccatccacaggacctccaacgtcctgacgctctcgctc
aagcgctttgccaacttcagcgggggcaagatcaccaaggaggtcggctatccggagttc
ctgaacatccgtccctacatgtcccagagtaacggcgagcccgtcctgtacgggctctac
gccgtcctggtccactcgggctacagctgccatgccggccactattactgctacgtgaag
gccagcagcggacagtggtaccagatgaacgactccttggtccacgccagcaacatcaag
gtggttctgaaccagcaggcctacgtgctcttctacctgcgaattccaggctctaagaag
agtccgcagggctccatctccaggacggcctcatcccttcccggctgccctggggcggct
ctggaccacgtcaaaaagagtgtcagcaacgggcccgcatcctccccaccggctggaaag
agaccagaccctgcgatgatgaagaagccacagacccccgaagagcttggggtgcccgtt
gccaggaatggttccgtgtcgggcctgaagcctcagaatggatacgcgcccccaaagcca
cctgtggggtccccctcccccaaactctccaaaacgcccacccacgcgcccacccttctg
gaggagcctggaaagaaagtcaagaaaccagccccgcctccgcccctctccccgccaccc
agaccctctcaggggccccgaggggctggcgagcctggaggcagcaggggtgagggccga
gggccgggcccctggggcggcaaggccagcctctccccctcgccccggcccctggccccc
gggaccgccaacgggcttgggccccaggcgggcgatgggggctccgctgctgagaggagg
ggatccggcggctccagccctgagcgctcagccggcagtggccccgccaggaacccccag
gccccccagggcggaagcacccacctctgcgagtctcagggaactccctccagggggccg
ccagcccaagaggatgccaggctggccaaggccaagtgccccatcctgagcggcgctgcg
cccgagcccgccaacaccatgtctcctccaccggccaaaaagctggccctttccgccaag
aaggccagcaccctgcggagggcagccagcagtgacctccgtccacctcccctctctccg
tcctccgacctcacccacccccggaaacccgctcaccccgcggccgcctccacctggcct
cgcagcacaatcagggctgtttcacctgctcccagaccatccagccatctgaagcccccc
ctcggcccccggcccccgtcactgcccagcagcccccagcctctcaggacatcagaccca
cagagctgctcgtccgcctctgcgcccctgcctcaggtcaatgggggcttccaggcccct
ccccaccagccgccagaggccagcgagccccccnagagcccctgtaagaagaagcggaag
ccctgcatggctgagaccgaggaccagggctgcgagacctgcacggccgcggcggcccca
cccgggaagcggcgaaggaggaagaggaagcacacgggggacgtggccgcctcctccccg
gccccgcaggaggggctgctacagggacagccgtggagtcccaagcgcaggaaggagggc
cggccggagccgccagcggacagatgggaggaagagggcggacagcagcaaggaaagcgc
tggcgcctggggagcagcggttggcccgggggatgtgtgagcgacagccaccaagtgaat
agcaggaagaggaggcggaagggagccgagggcctgggcggagaagccttggccagggac
ccgcctcggcgcgggaattgctctctctcggatgcggtcctgccagagaccacagcagca
tcacccaggaaaaagaagaagaaaaaaaggaaggaggagtcccagcagcacacagacgag
aaccagtccacaggccagaggggcaggagcgctgccgtccctgggagcctgctcctgctg
gctatgaacggccagggccccggggagcccacagggctgggacagactcctcttgtatct
tgggacggagagaaggaatctgatgtggtccaggaattgctgaagtactcatcagataaa
gcttacgggaggagagttttgacgtgggacggcgaggtgtccgctgtcagtcgggacgcc
gttcaggacagcaggctggcccgtgcggccacggtcatcgatgactgggatgaagcgttc
gaccggggcaaggaaaagaaagtgaaaaaattcaagagagaaaagaaaagaaacttcaac
gccttccagaaacttcagagtagacggaacttttggtccgtgactcacccagccaaggct
gccagcctcagccatcgccgctga

DBGET integrated database retrieval system