KEGG   Sus scrofa (pig): 100515302Help
Entry
100515302         CDS       T01009                                 

Definition
histone H2B type 1-P-like
Orthology
K11252  
histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100515302
  Immune diseases
   05322 Systemic lupus erythematosus
    100515302
  Substance dependence
   05034 Alcoholism
    100515302
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100515302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 126 aa AA seqDB search
MYKLSGLGGLEFFGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtataagttgagtggtttaggaggtttggagttttttggttctaagaaggctgttacc
aaagcgcagaaaaaagatggcaaaaagcgcaagcgcagccggaaagaaagctattccatc
tacgtgtacaaagtgttgaagcaagtacatcccgacacgggcatctcttctaaggccatg
ggcataatgaattccttcgtcaacgacatctttgagcgcatcgccagcgaggcttcccgc
ttggcgcactacaacaagcgctctaccatcacgtctcgggaggtgcagacagctgtgcgt
ctgctgttgcctggcgagctggccaaacacgccgtgtctgaaggtaccaaagccgtcacc
aagtacacgagctccaagtga

DBGET integrated database retrieval system