KEGG   Sus scrofa (pig): 100515363Help
Entry
100515363         CDS       T01009                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Ras signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ssc04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ssc04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1144 aa AA seqDB search
YYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVET
EKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFM
RGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMA
ASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIY
QEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLH
ELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDT
SQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLL
KTGGVLSLIDCTLIEEPDASDDDSKGSGQVFGHLDFKIVVEPPDAAPFTVVLLAPSRQEK
AAWTSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKV
PQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVR
SLELFFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIG
ALDLTTSSASSSPTTTHSPAGSPPPHTGKVPLDLSRGLSSPEQSPGAVEEHVDNPRVDLC
NKLKRSIQRAAVLESGPVDRAGVESSPATDATELSPCRSPSTPRHLRYRQPGGQTADNSH
CSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFIIRRSATNRVLNVLRHWVSKHAQDF
ELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQLTDCP
KAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDM
SNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWA
KVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTE
EGLVNFSKMRMISHIIREIRQFQQTSFRIDHQPKVTQYLLDKALIIDEDTLYDLSLKIEP
RLPA
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
tattacttcactgttcttttcggccacgaaggtcagaaaccactagagctgcgctgtgag
gaggagcaggacggtaaagagtggatggaggccattcaccaagctagttatgcagacatt
ttgattgagagggaagtgttaatgcagaagtacattcatctcgttcagatcgtagagaca
gaaaaaattgctgccaaccagctccggcatcagcttgaagatcaagatacagaaatcgaa
aggcttaaatcagagattatcgctcttaataaaaccaaggaacgaatgagaccttaccaa
agcaatcaagaagatgaggatccagacatcaagaagattaaaaaggttcagagcttcatg
cgaggctggttatgtagaaggaagtggaagaccatcgtgcaggattacatttgctctcct
catgctgaaagtatgaggaagagaaaccagattgtgttcaccatggtcgaggctgagtca
gagtatgttcaccagctctacatcctggtcaacggtttcctccggcccctgcgaatggca
gccagctccaagaagccccccatcagccatgatgatgtcagcagtatttttctcaacagt
gaaacaattatgtttcttcatgaaatatttcatcaaggactgaaggccaggatagccaac
tggcccacattaattttagctgatctgtttgatattttactccccatgctgaacatttat
caagaatttgtgcgtaatcaccagtacagcctccaagtgctcgccaattgtaagcaaaac
agagacttcgacaaactcttgaaacagtatgaagccaaccctgcctgtgaggggaggatg
ctggagacgtttctgacctatccaatgtttcagattcctaggtacatcatcacacttcat
gaactcctagctcatactccccatgagcatgtggagaggaaaagtctggaatttgctaaa
tcaaaactagaggaactatccagggtaatgcacgatgaagtgagcgacactgaaaacata
aggaagaaccttgccatagaaagaatgattgtggaaggctgtgatatcttgctggacacc
agccaaactttcatccgccaaggttctcttattcaagtaccttccgttgagagggggaaa
cttagtaaagttcgcctgggttcattgtctttgaaaaaggaaggagaaagacaatgcttc
ctatttacaaaacactttttaatttgtacaagaagttcaggaggaaagctgcatctgctc
aagacaggtggcgttctctctctcatagattgtacattgatcgaggagcctgatgcaagc
gatgatgactccaaaggttccgggcaagtgtttggacacctggattttaaaatagtggtg
gagcctcctgacgctgctcctttcactgtagtcttgttagcaccttcccgccaagagaaa
gctgcctggacaagtgacataagtcagtgtgtggacaacatacggtgtaatggtctaatg
accatagtgtttgaagaaaattccaaagtcactgtgccacatatgattaagtccgatgcc
cgtcttcacaaggatgacaccgacatttgcttcagtaaaacactcaactcctgcaaagtg
ccccagatccgttacgctagcgtggagcgcctcttggagcggctgacagacctgcggttt
cttagcatcgatttcctcaacacctttctgcacacctatcggattttcaccacagcagcc
gtggtgctggggaagctttccgacatatacaagaggcctttcacctcgatccccgtcagg
tcattggaattgttctttgccaccagccagaacaacagaggtgaacacttggtggatggc
aaatccccacgcctatgtcgcaaattctcttccccaccgccactggctgtgtccagaacg
tcctccccggtgagggccagaaagctgtccttgacttctcccttgaactcaaggatagga
gcattggacctgaccacctcctctgcgtccagcagccctaccaccacccacagccctgcc
gggtccccaccaccgcacactggtaaagtaccgctggatcttagcagaggcctttcttct
ccagaacaaagcccgggagctgtggaagagcatgtagataaccctcgcgtggatctgtgt
aacaagctgaaacgaagtattcaaagagcagcagtcctagagtctggaccagtggaccga
gcaggagtggaaagctccccagcgaccgatgccacagaactttcaccttgccggtcaccc
tcgactcctcggcacctccgctaccgccagcctggaggacagacggctgacaactcccac
tgctctgtttcacctgcttctgcttttgcaattgccacggctgcagcaggacacgggagt
ccaccaggatttaacaacaccgagagaacatgtgacaaagaattcattatacgtagatcg
gccaccaatcgagtactgaacgtcctccgtcactgggtctcaaagcacgcacaggatttt
gaactcaacaacgaactaaagatgaatgtcctaaatttgcttgaagaagttttgcgagac
ccagaccttcttccccaagaaaggaaagccacggcgaatatcctgagggccctttcacaa
gatgatcaagatgacatccacctaaaactagaggatataattcaattgacggactgtccg
aaggccgagtgctttgagaccctgtcggccatggagttggccgagcagatcacactcctg
gaccacatcgttttcaggagcattccctacgaagaattccttgggcaggggtggatgaag
ctggataaaaatgaaagaacaccttacattatgaaaaccagccagcacttcaatgatatg
agtaacctggtggcctcccagatcatgaattacgccgatgtcagctcccgagccaacgca
atcgagaagtgggtggctgtggcagacatctgccggtgtctgcacaactacaacggcgtg
ctggagatcacctcagccttgaaccgaagtgccatctaccggctgaagaaaacctgggcc
aaggtgtccaagcagacaaaagctctaatggacaagcttcagaagactgtttcatctgaa
ggaagatttaagaatctcagagaaactcttaaaaattgtaaccccccagctgttccttat
ctggggatgtacctgacagacctggcgtttattgaagaaggaacacccaactttactgag
gaaggccttgtcaatttctccaagatgagaatgatatcacacatcatcagagagattcgc
cagttccagcagacctcctttcgcatagaccatcagccaaaggtcacgcagtacttgctt
gacaaagccctcatcatagatgaagatacgctctatgatctgtcactaaaaattgaacct
cggctccctgcttga

DBGET integrated database retrieval system