KEGG   Sus scrofa (pig): 100515363Help
Entry
100515363         CDS       T01009                                 

Gene name
RASGRF2
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 2 isoform X1
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100515363 (RASGRF2)
   04010 MAPK signaling pathway
    100515363 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 1240 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERALAPPRAGTGPGGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTSSASSSPTTTHSPAGSPP
PHTGKVPLDLSRGLSSPEQSPGAVEEHVDNPRVDLCNKLKRSIQRAAVLESGPVDRAGVE
SSPATDATELSPCRSPSTPRHLRYRQPGGQTADNSHCSVSPASAFAIATAAAGHGSPPGF
NNTERTCDKEFIIRRSATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLL
PQERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIV
FRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKW
VAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFK
NLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQ
TSFRIDHQPKVTQYLLDKALIIDEDTLYDLSLKIEPRLPA
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgttacaatgaggggcacgccctgtacctggcctttctggcccgc
aaagagggcaccaagcgcggtttcctgagcaagaaggcagccgaggcgagccgctggcac
gaaaagtggttcgccctctaccagaatgtgctgttctactttgagggcgagcagagcggc
cgcccggccggcatgtacctcctggaaggctgcagctgcgagcgggcactcgcgccgccc
agggccggaaccgggccgggcggcgcccgggacgcgctggacaagcagtattacttcact
gttcttttcggccacgaaggtcagaaaccactagagctgcgctgtgaggaggagcaggac
ggtaaagagtggatggaggccattcaccaagctagttatgcagacattttgattgagagg
gaagtgttaatgcagaagtacattcatctcgttcagatcgtagagacagaaaaaattgct
gccaaccagctccggcatcagcttgaagatcaagatacagaaatcgaaaggcttaaatca
gagattatcgctcttaataaaaccaaggaacgaatgagaccttaccaaagcaatcaagaa
gatgaggatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggctggtta
tgtagaaggaagtggaagaccatcgtgcaggattacatttgctctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtcgaggctgagtcagagtatgttcac
cagctctacatcctggtcaacggtttcctccggcccctgcgaatggcagccagctccaag
aagccccccatcagccatgatgatgtcagcagtatttttctcaacagtgaaacaattatg
tttcttcatgaaatatttcatcaaggactgaaggccaggatagccaactggcccacatta
attttagctgatctgtttgatattttactccccatgctgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctccaagtgctcgccaattgtaagcaaaacagagacttcgac
aaactcttgaaacagtatgaagccaaccctgcctgtgaggggaggatgctggagacgttt
ctgacctatccaatgtttcagattcctaggtacatcatcacacttcatgaactcctagct
catactccccatgagcatgtggagaggaaaagtctggaatttgctaaatcaaaactagag
gaactatccagggtaatgcacgatgaagtgagcgacactgaaaacataaggaagaacctt
gccatagaaagaatgattgtggaaggctgtgatatcttgctggacaccagccaaactttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcattgtctttgaaaaaggaaggagaaagacaatgcttcctatttacaaaa
cactttttaatttgtacaagaagttcaggaggaaagctgcatctgctcaagacaggtggc
gttctctctctcatagattgtacattgatcgaggagcctgatgcaagcgatgatgactcc
aaaggttccgggcaagtgtttggacacctggattttaaaatagtggtggagcctcctgac
gctgctcctttcactgtagtcttgttagcaccttcccgccaagagaaagctgcctggaca
agtgacataagtcagtgtgtggacaacatacggtgtaatggtctaatgaccatagtgttt
gaagaaaattccaaagtcactgtgccacatatgattaagtccgatgcccgtcttcacaag
gatgacaccgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tacgctagcgtggagcgcctcttggagcggctgacagacctgcggtttcttagcatcgat
ttcctcaacacctttctgcacacctatcggattttcaccacagcagccgtggtgctgggg
aagctttccgacatatacaagaggcctttcacctcgatccccgtcaggtcattggaattg
ttctttgccaccagccagaacaacagaggtgaacacttggtggatggcaaatccccacgc
ctatgtcgcaaattctcttccccaccgccactggctgtgtccagaacgtcctccccggtg
agggccagaaagctgtccttgacttctcccttgaactcaaggataggagcattggacctg
accacctcctctgcgtccagcagccctaccaccacccacagccctgccgggtccccacca
ccgcacactggtaaagtaccgctggatcttagcagaggcctttcttctccagaacaaagc
ccgggagctgtggaagagcatgtagataaccctcgcgtggatctgtgtaacaagctgaaa
cgaagtattcaaagagcagcagtcctagagtctggaccagtggaccgagcaggagtggaa
agctccccagcgaccgatgccacagaactttcaccttgccggtcaccctcgactcctcgg
cacctccgctaccgccagcctggaggacagacggctgacaactcccactgctctgtttca
cctgcttctgcttttgcaattgccacggctgcagcaggacacgggagtccaccaggattt
aacaacaccgagagaacatgtgacaaagaattcattatacgtagatcggccaccaatcga
gtactgaacgtcctccgtcactgggtctcaaagcacgcacaggattttgaactcaacaac
gaactaaagatgaatgtcctaaatttgcttgaagaagttttgcgagacccagaccttctt
ccccaagaaaggaaagccacggcgaatatcctgagggccctttcacaagatgatcaagat
gacatccacctaaaactagaggatataattcaattgacggactgtccgaaggccgagtgc
tttgagaccctgtcggccatggagttggccgagcagatcacactcctggaccacatcgtt
ttcaggagcattccctacgaagaattccttgggcaggggtggatgaagctggataaaaat
gaaagaacaccttacattatgaaaaccagccagcacttcaatgatatgagtaacctggtg
gcctcccagatcatgaattacgccgatgtcagctcccgagccaacgcaatcgagaagtgg
gtggctgtggcagacatctgccggtgtctgcacaactacaacggcgtgctggagatcacc
tcagccttgaaccgaagtgccatctaccggctgaagaaaacctgggccaaggtgtccaag
cagacaaaagctctaatggacaagcttcagaagactgtttcatctgaaggaagatttaag
aatctcagagaaactcttaaaaattgtaaccccccagctgttccttatctggggatgtac
ctgacagacctggcgtttattgaagaaggaacacccaactttactgaggaaggccttgtc
aatttctccaagatgagaatgatatcacacatcatcagagagattcgccagttccagcag
acctcctttcgcatagaccatcagccaaaggtcacgcagtacttgcttgacaaagccctc
atcatagatgaagatacgctctatgatctgtcactaaaaattgaacctcggctccctgct
tga

DBGET integrated database retrieval system