KEGG   Sus scrofa (pig): 100515447Help
Entry
100515447         CDS       T01009                                 

Gene name
USP43
Definition
ubiquitin specific peptidase 43
Orthology
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 1123 aa AA seqDB search
MDPGAGAAAAEGPPAPRPRRRRSLRRLFTRFLLALGSRSRPGDSPSRPRSQPPPGHGDGD
GEGGFASAPGADPAAPGSPGEERPPRPQPQLPAGDGARPPGAQGLKNHGNTCFMNAVVQC
LSNTDLLAEFLALGRYRAVPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQF
QGNSQHDALEFLLWLLDRVHEDLEGSARGPTADKLLPEARKTSENPPSPSAQLSLGQSFV
QSHFQAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFLSQSQRFLRVGL
AVPILSTVAALRKMVAEEGGIPAAEVILVELYPNGLQRSFFDEEDLNTIAEGDNVYAFQA
PPSPGQEMLSACPPGLPVSPRLAAREGQRLSRPVPGENKVLILFCNLVGSGQQASRFGPP
FLIREDRAISWAQLQQSILNKVRYLMKGEAPVQNPGSLFSIRVVGLSLACSYLSPQDSRP
LCHWAVDRALHLRRPGGPSHVKLAVEWDSGTQERLFGSVQEERVQDADSVWQQQQAHQQH
SCTLDECFQFYTKEEQLAQDDAWRCPHCQALQQGVVKLSLWTLPDILIIHLKRFCQVGER
RNKLSTLVKFPLSGLDMAPHVAQRSTGPKGAPGPWPSWKQPACLPTSYPPDFLYDLYAVC
NHQGSLQGGHYTAYCRNSLDGQWYSYDDSTVEPLLEDEVNTRGAYILFYQKRNSIPPWSA
SSSMRGSTSSSLSDHWLLRLGSNDGSTRGSLLSWSSAPGPALPRGPEPAFATSSLPRQEK
GGSESRPLARGVQGRSISMKGRAPPRAKQGAFKTMPLRWSFGTREKPLGASVELVEYLES
RRRPRSTSQSIVPLLTAAAGGDEKSNATLSAASVDGGPAGDRVLAGAPCPSGHPSHCAVP
VNSDGPNAARKLKESASQDIRLPRQFDLPLPVMSSAENGRRAWPGDSSQAPSPKDALSTA
ALSRNSAGGRGNTLDKMRAGAERKDSETDRFPQGTLTLLRSVFWKKENRKSERAEAAPPA
APGSLGSGRLSPAVGEQARGSSPSLRIRESLARGPAGPLERDVRSAPSSLHLPRKAGRPP
RASALGTSQRIAPGEQTSLGALPKVKYHTLSLRRKKTLPESSL
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggacccgggcgcgggggccgcggccgcggaggggccgcccgcgccccggcccagacgc
cgccgctccctgcgccgcctgttcacccgcttcctgctggcgctgggcagccgctcccgc
cccggggactcaccgtcccggccccggtcccagcctcctccgggacacggcgatggcgac
ggggaagggggcttcgcgagcgccccaggagcggatccagccgcgcccggaagccccggg
gaggagcgcccgccgcgaccccagccccagcttcccgccggcgacggggcgcggcccccg
ggagcgcagggcttgaagaaccacggcaacacctgtttcatgaacgccgtggtgcagtgt
ctcagcaacaccgacctgctggccgagttcctggcgctggggcgctaccgggcggtgccg
ggccgcgccgaggtcaccgagcagctggcggcgctggtgcgcgcgctctggacgcgcgaa
tacacgccccaactttcagccgagttcaagaatgctgtctccaagtacggctctcagttc
caaggcaactcccagcacgacgccctggagttcctgctctggctgctggaccgtgtgcac
gaggacttggagggctcggcccggggcccgaccgccgacaagcttctccccgaagccagg
aagacctctgagaaccccccgtcgccatcggctcagctctctctaggccaaagctttgtc
caaagccacttccaagcacaatatagatcttccttgacctgcccccactgcctgaaacag
agcaacaccttcgaccctttcctgtgtgtgtcgctgccgatccccttgcgccagacgaga
ttcttgagcgtcaccttggtcttcctctctcagagccagcggttcctgcgggttggcctg
gctgtgcccatcctcagcacggtggcagccctgaggaagatggtcgcagaggaaggcggc
attcctgcggctgaggtgatcttggttgaactgtatcccaatgggctgcagcggtctttc
tttgatgaagaggacctgaatactattgcagagggagataatgtgtatgccttccaagcc
cctccatcacccggccaggagatgctctcagcttgtccacctggcctgcccgtctccccg
cgcttggctgcccgtgagggtcagagactatctcggcccgtccccggcgagaacaaggtg
ctaatccttttctgtaacttggtgggctcagggcagcaggccagcagatttgggccacct
ttcctgataagagaggacagggccatctcgtgggcccagctccagcagtccattctcaac
aaggtccggtatctcatgaagggcgaggcgcccgtacagaacccggggtcgctgttctcc
atccgggtcgtggggctctccctggcctgcagctacttgtccccacaggacagtcggccc
ctctgccactgggcagttgacagggctctgcacctcaggaggccgggaggcccctcgcac
gtcaaactggctgtggagtgggacagcggcacccaggagcgcctgttcgggagcgtccag
gaggagcgggtccaggacgcggacagcgtgtggcagcagcagcaggcgcaccagcagcac
agctgcaccctggacgagtgtttccagttctacaccaaggaggagcagctggcccaggac
gacgcgtggaggtgcccgcactgccaggccctccagcagggcgtggtgaagctgagcttg
tggacgctgcccgacatcctcatcatccacctcaaaaggttctgtcaggtgggcgagagg
agaaacaagctctccacgctggtgaagttcccgctctccgggctcgacatggctccccac
gtggcccagagaagcaccggccccaagggcgcgccgggcccctggccctcctggaagcag
ccggcctgcctgcccaccagctacccgccggacttcctgtacgacctgtacgccgtctgc
aaccaccagggcagtttgcaaggtgggcattacacagcctactgccggaactctctggac
ggccagtggtacagttacgatgacagcacagtggaaccgcttctagaagatgaggtcaat
acgcgaggggcttatatcctgttttatcagaagagaaacagcattcctccctggtcagcc
agcagctccatgagaggttccaccagctcctccttgtctgaccactggctcctccggctt
gggagcaatgatggcagcacgaggggcagcctgttgtcctggagctctgcccccggccct
gccctgccccgcggacctgagcccgccttcgccaccagcagcctgccccggcaggaaaag
ggaggctcggagtccaggcctctggcccggggtgtgcaaggccgaagcatcagcatgaag
ggccgtgcccctccccgagccaagcagggggccttcaagaccatgccccttcggtggtct
tttgggacccgggagaaacccctgggtgcatctgtcgagctggtggaatacttagagtcc
agaaggagacctcgatccacgagccaatccatcgtgccgctgctgaccgcggcggccggc
ggggacgagaagtccaatgccaccctttctgccgcgagtgtcgatggagggcccgccggt
gacagagtgctggccggagcgccctgcccctcgggacaccccagccactgtgccgtcccg
gtcaactcggatgggccaaacgcagccaggaaactcaaggaaagtgcaagtcaggatatc
aggctgcccaggcagttcgacctgcccctcccagtgatgtcctcagcggagaacgggagg
cgagcctggccgggggacagcagccaagcaccctcccccaaggatgctctgagcactgcc
gcgctgtctagaaacagtgctggtggtcgcggaaatactttggacaagatgcgggctggt
gcggagagaaaggactccgagacagacaggttcccgcaggggacactcaccctcctgagg
tccgtgttctggaagaaagagaacaggaagagcgagagggcggaggcggcccccccggcg
gcccccggctccctagggagcggcaggctgagccccgctgtgggtgagcaggcccgaggc
tcctctccatcgctcaggatccgagagagcctggccaggggtccagcgggccccctggaa
agggatgttcggtcagcccccagctctctgcacctccctcgcaaggccggcaggcccccg
cgggccagtgccctgggcacatcacagaggattgctcccggggaacagacgtctttgggc
gccttgccaaaggtgaagtaccacacgctctccttacgtcggaagaaaacattgcccgag
tccagcctctga

DBGET integrated database retrieval system