KEGG   Sus scrofa (pig): 100515460Help
Entry
100515460         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100515460
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100515460
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100515460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 904 aa AA seqDB search
MMACDSFCRRSSGPGLWGAISQPRGRFWTRPSLGPWPCSAGGGCMDEGKDGERGGDDDGG
QSSDWSRELEAGAAGGAEESVILTRSPRDSREQASLGNIELKETGPGCERASARGLRRGG
FPGASPASAAASFSESPFWVQLPEPPRSLRPGGGHPRSAWPPRRHAQRPPEPCEQGEEPP
PVEEAEEAEEAETAETAAKAERKVEAKVEGKVDAAGKVDAAGKVDAAGKVDATGKVDTAG
KVDAAGKVETAEGPGRRVELKLEPEPEPEPAREAEQEPKGEPKQEPEDENPARSGGGGGG
SDEVPLPTLPSDPPRPPDPSPRRSRAPRRRPRPRPQTRLRTPPQPRPRPPPRPRPRRGPG
GGCLDVDFAVGPPGCSHVNSFKVGENWRQELRVIYQCFVWCGTPETRKSKAKSCICHVCG
THLNRLHSCLSCVFFGCFTEKHIHEHAETKQHNLAVDLYYGGIYCFMCKDYVYDKDIEQI
AKEEQGEALKLQASTSTEVSHQQCSMPGLGEKYPTWETTKPELELLGHNPRRRRITSSFT
IGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELY
SGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDAGKAANNPNH
CNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGE
SHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFE
HSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNDENKYSLFAVVNHQG
TLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHESEKVKEMN
TQAY
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctgtgacagcttctgccggcgctcctcaggaccgggcctctggggggccatt
tcccagcctcggggacgtttctggacccggccatccctcggtccctggccctgcagtgct
gggggaggctgcatggacgaagggaaggacggggagaggggaggagacgatgatgggggt
caaagcagcgattggagccgagaactggaagctggggccgcgggtggagccgaggaatct
gtaattttaacacgctccccacgtgattctcgtgaacaagcaagtttgggaaatattgaa
ttaaaggaaacggggcctggctgcgagcgggcctccgctagagggctacggcggggagga
ttcccgggggcgtcgcctgcttccgccgccgcctccttcagtgaaagtcccttttgggtc
cagctgccagagccaccgcgctccctcaggccgggcgggggacaccccaggtctgcgtgg
cccccgcgccgccacgcccagcggccgcccgagccctgcgagcagggggaggagccgccg
ccagtggaggaggcggaggaggcagaggaggcggagacggcggagacggcggcgaaggcg
gagaggaaggtggaggcgaaggtggaggggaaggtggacgcggcggggaaggtggacgcg
gcggggaaggtggacgcggcggggaaggtggacgccaccgggaaagtggacacggcaggg
aaggtggacgccgccgggaaggtggagacggcggagggtccgggccgccgggttgagctc
aagctggagcccgaacccgaacccgagccggcacgggaggcggagcaggagccgaagggg
gagccgaagcaggagccggaggatgagaacccagcgcggagcggcggtggcggcggcggc
agcgacgaggttcctctccccacccttccctctgaccccccgcggccccccgatccctcc
ccgcggcgcagccgtgccccccgccgccgaccccggccgcggccgcagacccggctccgt
accccgccgcagcctaggccacggcccccgccccggccccggccccggcgcggccctggg
ggcggatgcctggatgtggatttcgctgtgggtccaccaggctgttcccacgtgaacagc
tttaaggtgggagagaactggaggcaggaactgcgggtcatctaccagtgcttcgtgtgg
tgtggaacccccgagaccaggaaaagcaaggcaaagtcgtgcatctgccatgtgtgcggc
acccatttgaacagactccactcttgcctttcctgtgtcttctttggctgcttcacagag
aaacacattcacgagcacgccgagacaaaacaacacaacttagctgtagacctttattac
ggaggtatatactgctttatgtgtaaggactatgtatatgacaaagacattgagcaaatt
gccaaagaagagcaaggggaggctttgaaattacaagcctccacctccaccgaggtttct
caccagcagtgttcgatgccaggcctcggtgagaaatatccaacctgggagacaaccaaa
cccgagttagaactgctgggacacaacccaaggaggagaagaattacctccagctttacc
atcggtttaagaggactaatcaatcttggcaacacgtgctttatgaactgcatcgtccag
gcccttacccacactcccatcctgagagatttcttcctctctgacaggcacagatgtgaa
atgccaagccccgagttgtgtctggtctgtgagatgtcttcgctctttcgggagttgtat
tctggaaacccgtctcctcacgttccctataagttactgcacctggtctggatacacgcg
cgtcacttagcagggtaccggcaacaggatgcccacgagttcctcatcgcagcgttagac
gtcctgcacaggcactgcaaaggtgatgatgccgggaaggcggccaacaatcccaaccac
tgtaactgcatcattgaccaaatcttcacaggtggcttgcaatccgatgtcacctgtcaa
gcctgccatggggtgtccaccacgatagacccctgctgggacatcagtttggacttgcct
ggctcttgcacctccttctggccaatgagcccagggagggagagcagtgtgaatggggaa
agccacatcccaggcatcaccaccctcacggactgcttgcgaaggtttacgaggccagag
cacttaggaagcagtgccaaaatcaagtgcggtagttgccagagctaccaggaatctacc
aaacagctcacaatgaataaattacccgtcgttgcctgttttcatttcaaacgttttgaa
cactcagccaaacagaggcgcaagatcactacatacatatcctttcctctggagctggat
atgacaccattcatggcctcgagcaaagagagcaggatgaatggacagttgcagctgcca
accaatagtggaaacgacgagaataagtattccttgtttgctgtggttaatcaccaagga
accttggagagtggccactacaccagcttcatccggcaccacaaggaccagtggttcaag
tgtgatgatgccgtcatcaccaaggccagtattaaggacgttctggacagtgaagggtat
ttactgttctatcacaaacaggtcctggaacatgagtcagaaaaagtgaaagaaatgaac
acacaagcctactga

DBGET integrated database retrieval system