KEGG   Sus scrofa (pig): 100515779Help
Entry
100515779         CDS       T01009                                 

Gene name
DYRK2
Definition
(RefSeq) dual specificity tyrosine phosphorylation regulated kinase 2
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100515779 (DYRK2)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100515779 (DYRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 601 aa AA seqDB search
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGAPRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLESIHRRQGSSTSLKSLEGMGKVKATPMTPEQAMKQYMQKLTSFEHHEIFSYPE
IYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIEKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaggaaaccttcggccgccgctcccgccgcctacccgaccggccgaggaggg
gacagcgccgttcgtcagcttcaggcttccccggggctcggtgcaggggccccccggagc
ggagtggggaccggcccgccctcccccatcgccctgccgcctctccgggccagcaacgct
gccgccgcagcccacacgattggcggcagtaagcacacaatgaatgatcacctacacgtc
ggcagccacagccacggacagatccaggttcagcagctgtttgaggataacagcaacaag
cggacagtgctcacgacacaaccaaatgggcttacaacagtgggcaaaacggggttgccc
gtggtgccggagcggcagctggagagcatccacagacggcaggggagctccacctctctg
aagtctctggaaggcatggggaaggtgaaagccactcccatgacacccgagcaagcaatg
aagcaatacatgcaaaaactaaccagctttgaacaccatgagattttcagctaccctgag
atatatttcttgggtccaaatgcaaagaagcgccagggcatgacaggcgggcccaacaac
ggtggctacgatgatgaccagggatcctacgtgcaggtgccccacgatcacgtggcctac
aggtacgaggtcctcaaggtcattgagaaggggagcttcgggcaggtggtcaaggcctac
gaccacaaagtccaccagcacgtggctctgaagatggtgcggaacgagaagcgcttccac
cggcaggcggccgaggagatccgcatcctggagcacctgcgcaagcaggacaaggacaac
accatgaacgtcatccacatgctggagaacttcaccttccgcaaccacatctgcatgacg
ttcgagctgctgagcatgaacctctacgagctcatcaagaagaacaagttccagggcttc
agcctgcctttggttcgcaagtttgcccactccatcctgcagtgcctggacgctctgcac
aaaaacaggatcattcactgtgacctgaagcctgagaacattttattgaagcagcagggt
agaagtgggattaaagtgattgatttcggctccagttgttacgagcatcagcgggtctac
acgtacatccagtcccgtttttaccgggccccggaagtgatcctgggcgccaggtacggc
atgcccattgacatgtggagcctgggctgcatcctcgcggagctcctcactggttacccc
ctcttgcctggggaggacgaaggggaccagctggcctgtatgattgaactgctgggcatg
ccctcccagaaactgctggatgcctccaaacgagccaaaaattttgtgagctccaagggt
tatccccgttactgcactgtcacgactctctcggacggctccgtggttctcaacggaggc
cgttcccggagggggaaactgcggggcccaccagagagcagagagtgggggaatgcactg
aaggggtgtgacgacccccttttccttgacttcttaaaacagtgtttagagtgggatcct
gcggttcgcatgacccctggccaggctttgcggcacccttggctgaggaggcggctgcca
aagcctccgacgggggagaagacgtcagtgaaaaggatcaccgagagcactggtgctatc
acatccatttccaagttacctccaccttccagctcagcttccaaactgaggactaatttg
gcacagatgacagatgccaacgggaatattcagcagaggacagtgttgccaaaacttgtt
agctga

DBGET integrated database retrieval system