KEGG   Sus scrofa (pig): 100515779Help
Entry
100515779         CDS       T01009                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100515779
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   100515779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 528 aa AA seqDB search
MNDHLHVGSHSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLESIHRR
QGSSTSLKSLEGMGKVKATPMTPEQAMKQYMQKLTSFEHHEIFSYPEIYFLGPNAKKRQG
MTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIEKGSFGQVVKAYDHKVHQHVALKMV
RNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIK
KNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSC
YEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLAC
MIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPES
REWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRI
TESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcacctacacgtcggcagccacagccacggacagatccaggttcagcagctg
tttgaggataacagcaacaagcggacagtgctcacgacacaaccaaatgggcttacaaca
gtgggcaaaacggggttgcccgtggtgccggagcggcagctggagagcatccacagacgg
caggggagctccacctctctgaagtctctggaaggcatggggaaggtgaaagccactccc
atgacacccgagcaagcaatgaagcaatacatgcaaaaactaaccagctttgaacaccat
gagattttcagctaccctgagatatatttcttgggtccaaatgcaaagaagcgccagggc
atgacaggcgggcccaacaacggtggctacgatgatgaccagggatcctacgtgcaggtg
ccccacgatcacgtggcctacaggtacgaggtcctcaaggtcattgagaaggggagcttc
gggcaggtggtcaaggcctacgaccacaaagtccaccagcacgtggctctgaagatggtg
cggaacgagaagcgcttccaccggcaggcggccgaggagatccgcatcctggagcacctg
cgcaagcaggacaaggacaacaccatgaacgtcatccacatgctggagaacttcaccttc
cgcaaccacatctgcatgacgttcgagctgctgagcatgaacctctacgagctcatcaag
aagaacaagttccagggcttcagcctgcctttggttcgcaagtttgcccactccatcctg
cagtgcctggacgctctgcacaaaaacaggatcattcactgtgacctgaagcctgagaac
attttattgaagcagcagggtagaagtgggattaaagtgattgatttcggctccagttgt
tacgagcatcagcgggtctacacgtacatccagtcccgtttttaccgggccccggaagtg
atcctgggcgccaggtacggcatgcccattgacatgtggagcctgggctgcatcctcgcg
gagctcctcactggttaccccctcttgcctggggaggacgaaggggaccagctggcctgt
atgattgaactgctgggcatgccctcccagaaactgctggatgcctccaaacgagccaaa
aattttgtgagctccaagggttatccccgttactgcactgtcacgactctctcggacggc
tccgtggttctcaacggaggccgttcccggagggggaaactgcggggcccaccagagagc
agagagtgggggaatgcactgaaggggtgtgacgacccccttttccttgacttcttaaaa
cagtgtttagagtgggatcctgcggttcgcatgacccctggccaggctttgcggcaccct
tggctgaggaggcggctgccaaagcctccgacgggggagaagacgtcagtgaaaaggatc
accgagagcactggtgctatcacatccatttccaagttacctccaccttccagctcagct
tccaaactgaggactaatttggcacagatgacagatgccaacgggaatattcagcagagg
acagtgttgccaaaacttgttagctga

DBGET integrated database retrieval system