KEGG   Sus scrofa (pig): 100515917Help
Entry
100515917         CDS       T01009                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ssc  Sus scrofa (pig)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ssc00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 308 aa AA seqDB search
MACGHTVLMRLVASAYAVAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPPEEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHSNQLVMDCVTAMNPDDVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPQ
SVKNALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcggtcacactgtgttgatgcggttggtggcctcagcgtatgctgtggcccag
aaggccgggatgatcgtcaggcgagttattgccgaaggagacctgggtatcgtggagaag
acctgtgcgacggacctgcagaccaaggccgaccgattagttcagatgagcatatgttct
tccctggcacggaagttccccaaactgacaattataggggaagaggatctgcctcctgaa
gaagtggatcaggagctgattgaagatggccagtgggaggagatcctgaagcagccctgc
ccgtcacagtacagcgccatcaaggaggaggatcttgtcgtctgggttgatccactggat
ggtaccaaagaatatactgaaggtcttcttgacaatgtaacggttcttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaactaccaggcagga
ccagatgctgtgttggggagaaccatctggggagttttaggtttaggtgcctttgggttc
cagctgaaagaagtgcctgccgggaaacacattatcacaaccacccggtcccacagcaac
cagctggttatggactgtgtgacggctatgaaccctgatgatgtgcttcgagtgggagga
gcaggaaataagattatccagctgatcgaaggcaaagcctctgcttacgtatttgcaagt
cctggatgtaagaagtgggatacctgtgctcctgaagttattttacatgctgtgggaggc
aagttaaccgacatccatggaaatgcccttcagtataacaaggaagtgaagcacatgaac
tcggcgggagtcctggccacgctgaggaattacgactactatgcaagtcgagttccccag
tctgtcaaaaatgcacttgtgccttga

DBGET integrated database retrieval system