KEGG   Sus scrofa (pig): 100515917Help
Entry
100515917         CDS       T01009                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ssc  Sus scrofa (pig)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100515917 (BPNT1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100515917 (BPNT1)
Transfer RNA biogenesis [BR:ssc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100515917 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 308 aa AA seqDB search
MACGHTVLMRLVASAYAVAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPPEEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHSNQLVMDCVTAMNPDDVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPQ
SVKNALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcggtcacactgtgttgatgcggttggtggcctcagcgtatgctgtggcccag
aaggccgggatgatcgtcaggcgagttattgccgaaggagacctgggtatcgtggagaag
acctgtgcgacggacctgcagaccaaggccgaccgattagttcagatgagcatatgttct
tccctggcacggaagttccccaaactgacaattataggggaagaggatctgcctcctgaa
gaagtggatcaggagctgattgaagatggccagtgggaggagatcctgaagcagccctgc
ccgtcacagtacagcgccatcaaggaggaggatcttgtcgtctgggttgatccactggat
ggtaccaaagaatatactgaaggtcttcttgacaatgtaacggttcttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaactaccaggcagga
ccagatgctgtgttggggagaaccatctggggagttttaggtttaggtgcctttgggttc
cagctgaaagaagtgcctgccgggaaacacattatcacaaccacccggtcccacagcaac
cagctggttatggactgtgtgacggctatgaaccctgatgatgtgcttcgagtgggagga
gcaggaaataagattatccagctgatcgaaggcaaagcctctgcttacgtatttgcaagt
cctggatgtaagaagtgggatacctgtgctcctgaagttattttacatgctgtgggaggc
aagttaaccgacatccatggaaatgcccttcagtataacaaggaagtgaagcacatgaac
tcggcgggagtcctggccacgctgaggaattacgactactatgcaagtcgagttccccag
tctgtcaaaaatgcacttgtgccttga

DBGET integrated database retrieval system