KEGG   Sus scrofa (pig): 100515989Help
Entry
100515989         CDS       T01009                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100515989 (USP26)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100515989 (USP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 904 aa AA seqDB search
MAALVAHGFVQIWSRKTGMSKSKEAFIQTVERKSKVRLVVYFRTGEHTTFRLSNNIKSVV
LRSYGKKQNHVHLTFQDNSFLFIEKLSSRDAENLKAFLDRVHENNLQPPIRPDRDGSVFA
STAVRKPVNKTSFHKTCKKSGSPSFEKGGKNETPDLEKMPLFASKSSTLTWEELLENGYG
KRKKMLSSGSEMNRNFLKENIFVRKKRSKTNPFRHASHKERKESRLKQNKKLEFGPSFKI
SSTGKPYLDGVGLLQMLTKNIYLAFLSESKYGEDDPDWDKLKMTLDFYPEKLWQGFPNLG
NTCYMNAVLQSLFSIPSFADDLLSQGFPWGKIPLDALNMCLAQLLVLKDIYNIKIKERLL
VNIKKAISAVAEIFSDNIQNDAHEFLGQCLDQMKENMGQLNSIWETTFESEQGDSPQQVL
TGSTATEMLVCPVITNFEFELLCSIVCKACGQVVLKTEVSNYLSINLPQGTEALPLSIQS
SFDHFFGAEELEYQCEKCKHRGSVAVHKFGRLPRVLIVHLKRYSFNEFWSLKKDDQEVII
SKYLKLSSHCSESTKPPLPLSKNAHIREFQILKIFQRINSEIFGLSTPSAEPTSESKDSL
AAHIGSEKEAESQKYQILDKGLSGEQQKDLGKSTPNVMDSTLLNSGDGAAIARELLAVSL
MMDLEDNFLSPKGKPTSSTCQEVPENPKLKKCKRSNMFVDLEGVTETIKHVCKDKPSRIS
EVFHQESEQAQQYERLRLYEQALWLALLQSLPKPGARYTKNPRRPTEVHFQGADVNSLGA
LGSDKNPGNKKCLDRKTEPETKKPKRNAEMEDPHAYRLIGVVSHLGKTPNSGHYISDAYD
FERQVWFTYNDLQVSSIQEAPMQEARLCTGYIFFYMHNEIFEELLEREENSQPHSTEAGK
TPRE
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctagtggcacatggttttgtccaaatatggagcaggaaaactggtatgtct
aagtcgaaagaagcattcattcaaacagtagaaagaaagagcaaagttagattggtggtc
tatttccgtactggagagcatacaacttttcgtctaagtaataatattaaaagcgtggtc
cttagatcctatggaaaaaaacaaaaccacgtgcacttaacgttccaagataatagcttc
ttgttcattgaaaaattatcctccagagatgctgaaaatttgaaggcattcctggatagg
gtccatgaaaataatcttcaaccacccataagacctgatagggatgggagcgtctttgcc
agcacagcagtacgcaagccagtcaacaaaacttcatttcacaaaacatgtaagaagtca
ggtagtccatcttttgagaaagggggaaaaaatgaaacacctgatcttgagaagatgcct
ttgtttgcttcaaaatcatcaacattgacttgggaagagttattagaaaatggatatggg
aagagaaaaaagatgctgtcatctggctcagagatgaataggaatttcctgaaagagaac
atctttgtaagaaagaagaggtctaagacaaatcccttcaggcatgcaagccacaaggag
aggaaagaatcaaggttaaaacagaataagaaattggaatttgggccttcattcaagatc
agttctactggaaaaccttacctagatggcgttggtcttctccagatgctgactaagaat
atatatttggcatttctgtccgaatccaagtatggtgaggatgacccagactgggacaaa
ctcaagatgaccttggacttttatccagagaaactatggcaaggcttccccaatttggga
aacacctgttacatgaatgctgttttacagtccctattttcaattccatcatttgctgat
gatttactcagtcagggtttcccatggggtaaaattcccctcgatgcacttaacatgtgc
ttggcacagctgcttgtcttaaaagacatttataacataaaaatcaaggagaggttactt
gtgaatattaagaaagccatttcagcagttgcagagatattctctgacaacattcagaat
gatgctcatgagtttttaggtcaatgtttagatcagatgaaagaaaacatgggacaatta
aactcgatttgggagaccacatttgagtctgagcaaggagattcacctcaacaggttctc
accggcagtactgccaccgaaatgcttgtctgtcctgtcatcactaattttgagtttgag
ttgctgtgctcaattgtttgtaaagcctgtgggcaggttgttcttaagacagaagtgagt
aattatctctccatcaaccttccccaaggaacggaagcacttcccttgtctattcagtct
agttttgatcatttctttggagcagaagagcttgagtatcaatgtgagaagtgtaagcac
aggggttccgttgctgtgcacaagttcggcaggctgcccagggtcctcattgtccatctg
aaacgctatagctttaatgagttttggtctttaaaaaaggatgaccaagaggtcattatt
tccaaatatttaaagttatcttcccattgcagtgaaagcaccaaaccaccacttccctta
agcaagaatgcacatattagggagttccagatcttaaaaatctttcaaaggataaattcc
gaaatcttcggtttatcaacgccttcagcagaaccgacctcggaatccaaggattccttg
gctgctcacattggatcggaaaaagaggctgagtcacaaaaataccagattcttgataaa
ggtttaagtggagaacagcaaaaagacctgggaaaatctacaccgaatgtaatggactcc
acattgttaaactcaggagatggagcagccattgcaagagagctattagcagtgagctta
atgatggatctggaagacaacttcctttctccgaaaggtaaacccaccagcagcacatgt
caagaagtgcctgaaaatccaaaactaaagaaatgcaagagatccaacatgtttgtagat
cttgagggtgtcactgagactatcaagcatgtttgtaaagataaaccctccagaatttca
gaagtatttcaccaagagtctgaacaggcgcagcagtatgaaaggctgagactctatgaa
caagccctttggctggcactgcttcaaagccttccaaagccaggtgcccggtacacaaag
aacccgagaagacctacagaagtacattttcagggggccgatgtgaattccctaggtgca
ttgggttccgataaaaaccctggaaacaaaaaatgtttagataggaagacagaacctgaa
accaagaaaccaaaaagaaatgccgagatggaggatcctcatgcctatcggctcattggt
gttgtcagccatcttgggaagacccccaattcgggccattatatcagcgatgcctacgac
tttgagaggcaagtctggttcacttacaatgatctgcaggtatcaagtatccaagaggcc
ccaatgcaggaggctaggctttgcactgggtacatcttcttttacatgcacaatgagatc
tttgaagagctgttggaaagagaagagaactcccagcctcatagcacagaggcagggaag
acccctcgggagtag

DBGET integrated database retrieval system