KEGG   Sus scrofa (pig): 100516037Help
Entry
100516037         CDS       T01009                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 407 aa AA seqDB search
MRWVRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKEPEPPRACCRFTDALVTIR
NRHNDVVPTMAQGVLEYKDAYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINASNAKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLTLPSIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQLGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggtccgcgcgctactgaagaatgcgtccctggcaggggcgcccaagtacatc
gagcacttcagcaagttctccccgtccccgttgtccatgaagcagtttctggacttcgga
tccagcaatgcctgtgagaaaacctcgttcaccttcctcaggcaggagctgccagtgcgc
ctggccaacatcatgaaagagatcaacctgcttcccgaccgggtgctgagcacaccctcg
gtgcagctggtacagagctggtatgtccagagtctcctggacatcatggagttcctggac
aaggaacctgaaccgccccgcgcctgctgcaggttcaccgacgccctggtcaccatccgg
aaccgccacaatgacgtggtacccaccatggcgcagggcgtgctggagtacaaggacgcc
tacggcgacgacccggtctccaaccagaacatccagtacttcctggaccgcttctacctc
agccgcatctccatccgcatgctcatcaaccagcacaccctgatctttgatggcagcacg
aacccagcccaccctaaacacattggcagcattgaccccaactgcaacgtctctgaggtg
gtgaaagatgcctacgacatggccaagcttctgtgtgacaagtattacatggcctcacct
gacctggagatccaggagatcaatgcatccaacgccaaacagccaattcacatggtctat
gtcccctcccacctctaccacatgctgtttgaactcttcaagaacgccatgcgagcaact
gtggaaagccatgaatccagcctcactctcccatctatcaaggtcatggtggccttgggc
gaggaagatctttccatcaaaatgagtgatcgaggtggaggtgtccccttgaggaagatc
gagcgactctttagctacatgtactccacagcccccacgccccagcttggcactgggggc
accccactggctggctttgggtatggactccccatttcgcgcctctatgccaagtacttc
cagggggacctgcagctcttctccatggagggctttgggactgatgctgtcatctatctc
aaggccttgtccacggactcagtggagcgcctgcccgtctacaacaagtcagcctggcgc
cactaccagaccatccaggaggccggcgactggtgtgtgcccagcacggagcccaagaac
acgtccacgtaccgtgtcagctaa

DBGET integrated database retrieval system