KEGG   Sus scrofa (pig): 100516123Help
Entry
100516123         CDS       T01009                                 

Gene name
UNC13C
Definition
(RefSeq) unc-13 homolog C (C. elegans)
  KO
K15293  
protein unc-13 A/B/C
Organism
ssc  Sus scrofa (pig)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100516123 (UNC13C)
Membrane trafficking [BR:ssc04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100516123 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1824 aa AA seqDB search
MVANLFKSLILPYIHKLCKGMFTKKLGNTTKKKENRQLKKDQDIPTANQTKPPKFSNTLK
STVKKIAKCSSARNLSTEEDEANREFSLSPTFSYRVAIANGLQKRVQVTNGDNEDLLQEL
SSIESSYSESLSELRSSTENQAQTTHTMPVRRNRKSSSSLAPSEGSSDGERTLHSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKTWGIRSKSLDRTARTPKTNTLEPGFSSSGCISQTQ
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYIESVVYQILVDKMGFSDVPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIKERKERG
IPSSQTYESMDIKLSTPEPRIKKDNWQSPDDSDGELGSDLNRNSYAVLSKSEFPTKGSAS
KSSSKSHNARAKNKTASSSRIPNKSEYDKISSHLPESDNLAKQGTTHYADVTPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGLYDSPQD
QCLDGAPQGIQVQSETENAETVDSGMSNGVVCVSGDQSHYSDSQLSLHEDLSPWKEWNQV
KQGADLGLDSSTQEAFDYDTNSLSDRQLDVYPKDLEDLGKCHGDLQDDFESYDLIQDDNS
SPCPGLDNEPQGQWVGQYNSYQEPNSNELYQNQNQLSLMYRSHSELQSDDSEDAPPKSWH
SRLSIDLSDKAFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQST
ANESSTTLDSDVYTEPYYYKAEDEEDYSEPVADHETDYVEVMEQVLAKLENRTSVTETDE
QMQEYDHPSYETPYETPQDEGYDGQGDDVISEGGLEPFNETSAEMEIKEDENQNIPEQPA
EVTKPKRIRPSFKEAALKAYKKQMAELEEKILAGDSNSVDEKARIVSGNDLDASKFSALQ
AFGGVPMRAGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEEL
KIHVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDKTQTIISAMKERMKIREKNRPEVFEVIQEMFQIS
KEDFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRT
KTIFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEV
RTLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTE
VKSNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPG
VPAVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSK
YRENFPASNAERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKY
IFDNCYELYSQLIDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQ
FPQELNMGKISAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELP
AFKDAVPEYSLWFEPFVLQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDV
FAQLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCI
LMNNIQQLRVQLEKMFESMGGKEV
NT seq 5473 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaatcttttcaagagcctgattttaccttacatacacaagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaaaaaagagaatcgccagctaaaaaag
gatcaagacattcctaccgccaaccagacgaaaccccccaaattttcgaataccttgaaa
agcactgtaaagaagattgccaagtgttcctctgcccgcaacttatccactgaggaagac
gaggctaacagagaattctccctctcccccacgttcagttaccgagtcgctattgccaat
ggcctccagaagcgcgtccaggtaaccaatggtgataatgaggatcttcttcaagagtta
tcttccatcgagagctcctactcagaatcactcagtgaactaaggagcagtacagagaac
caggcacagacaacacacacgatgccagtgagacgcaacaggaagagttcgagcagcctg
gctccctctgaggggagctctgatggggaacgcactctgcatagcttgaaactaggagct
ttacgcaaactgaggaaatggaaaaagagtcaagagtgtgtctcctcagattcagagttg
agcacaatgaagaaaacttggggaataagaagcaaatctttggacagaactgcccgaacc
ccaaagacaaacaccctggaacctggattcagttcctctggctgcattagccaaacacag
gatgtcatggaaatgatctttaaggaacttcaaggaataagtcagatcgaaacagagctt
tctgaactccgagggcatgtcaatgctctcaagcattccatcgatgagatctccagcagt
gtggaggttgtgcaaagtgaaattgagcagctccggacgggattcgtccagtctcggagg
gaaaccagagacatccatgattatattaaacacttaggtcatatgggtagcaaggcaagc
ctgaggtttttaaatgtgcctgaagaaagatttgaatatattgaaagtgtggtgtaccaa
attctggtagataaaatggggttttcagatgtcccaaatgctattaaaattgaatttgct
cagagaataggacaccaaagggactgtcccaatgcaaagccacggcccatcttggtgtac
tttgaaacccctcagcaaagggattccgttttaaaaaaatcatataaactcaaaggaaca
ggcattgggatctccacagatattctcactcatgacatcaaagaaagaaaagagagagga
ataccatcctcccagacatatgagagtatggatataaagctgtcaactccagagcccaga
atcaagaaggataattggcagtcacctgatgacagtgatggagagctgggatctgacctc
aatagaaacagttatgctgtgctttccaaatcggagtttccaacaaaaggaagtgcttcc
aagtcaagttcaaaatcgcacaatgctagagccaagaataaaactgctagtagcagcaga
attccaaataaatcagaatatgataaaatttcctcacatctgccagaatcagataacttg
gcaaaacagggcacaacccattatgcagacgtgacacctctctggcactcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagacttttccaaattgtgtcaatcttat
tcggaggatttttcagaaaatcagtttttcactagaactaatggaagctccctcctgtca
tcttcagaccgggaactttggcagaggaagcaggagggcttgtatgacagccctcaggat
cagtgtttggatggggcccctcagggtatccaagtgcagagtgaaactgagaacgcagaa
accgtggatagtggaatgagtaatggtgtggtgtgtgtatctggagaccagagtcattac
agcgattctcagctctctttacatgaggacctctctccatggaaagagtggaatcaggta
aagcaaggagctgacttaggtctagattcatccacccaggaagcttttgactatgacaca
aacagcctctctgatcgacaactagatgtttaccctaaagacttagaggacttgggaaag
tgccatggtgaccttcaggatgactttgagagctatgatttaatccaagatgacaactca
tctccgtgccctggattggataatgaaccccaaggacagtgggttggtcagtataattct
taccaggaacctaattctaatgagctataccaaaaccaaaaccagttgtccctgatgtat
cgaagtcatagtgaattgcagagtgatgattcagaggatgccccacccaaatcttggcat
agtcgattaagcattgacctttctgataaggcttttagcttccccaaatttggatccaca
ctacaaagggctaaatcagccttggaagtggtatggaacaaaagcacacagagtcttagt
ggatatgaggacagtggctcttccttaatggggcgatttcggacattatcccaatcaact
gcaaatgaatcaagtaccacccttgactctgatgtctacacagagccttattactacaaa
gcagaggatgaggaggactacagtgaaccggtggctgatcatgaaacagattacgttgaa
gtgatggaacaagtccttgctaagctagaaaacaggactagtgttactgaaacagatgaa
caaatgcaggaatatgatcacccttcatatgaaacaccttatgaaaccccacaagatgaa
ggttatgatgggcagggagatgatgtaattagtgaagggggattggaacccttcaatgaa
acatcagctgaaatggaaataaaagaagatgaaaaccaaaacatccctgagcaaccagcg
gaagtcacaaagccaaagcggattcgtccctctttcaaagaagcagctttgaaagcctat
aaaaagcaaatggcagaattggaagagaagatcctggctggagatagcaattctgtggat
gaaaaggctcgaatagtaagtggcaatgatttggatgcatccaaattctctgcactgcag
gcgtttggtggtgtccctatgagagctgggcggggactttatggtattgacagcatgcca
gatcttcgcaggaaaaaaactctgcctattgtacgagatgtggccatgaccctggctgcc
cggaaatctggactctccctggctatggtgattaggacatcgctaaacaatgaggaattg
aaaattcacgtcttcaagaagactttgcaagcgctgatctaccccatgtcctctaccacc
ccacacaattttgaggtctggacagcgacgacacctacctactgttatgagtgtgaaggg
ctcctgtggggcattgctcggcaaggcatgaagtgtttggagtgcggagtgaagtgccac
gaaaagtgccaggacctcctcaatgctgactgtttgcagagagcagcagaaaagagttct
aagcatggtgcagaagacaagactcagaccattatttcagctatgaaagaaagaatgaag
atcagggagaaaaacaggccagaggtgtttgaagtcattcaggaaatgtttcagatttct
aaagaagattttgtgcagtacacaaaggcagccaaacagagtgtactggatgggacatct
aagtggtcagcaaaaataaccattacagtggtttctgcacaaggcttgcaggcaaaggac
aaaacagggtcaagtgacccatatgttacggttcaagtcgggaagaacaaaagaaggact
aaaaccatttttggaaacttgaatccagtatgggatgagaagttttattttgaatgccat
aactccacagatcgaatcaaagtcagagtgtgggatgaagatgatgacattaaatccaga
gtgaagcaacatttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtg
aggaccctaagtggagaaatggatgtgtggtacaatttagagaaacgtacagataaatca
gctgtatctggggctattcgattgaaaatcaatgtggaaataaaaggagaggagaaggtt
gctccatatcatatacaatatacctgtttacatgagaatctgttccattatttgactgaa
gtgaaatctaatggtggagtgaaaattccagaagtcaaaggggatgaagcctggaaggtt
ttctttgatgatgcttcccaagaaattgttgatgaatttgccatgcgatatgggattgaa
tccatttaccaagctatgacgcacttttcatgtctgtcttccaagtacatgtgcccgggt
gtccctgctgtaatgagcaccttgctggcaaatataaatgctttctatgctcacacaact
gtttcaacaaatgtacaggtttctgcatcagatcgatttgctgctaccaactttggtagg
gaaaaattcatcaaactattggaccagttgcataactctttaaggattgacctttcgaag
tatagggaaaactttcctgctagcaatgcagaaagactgcaagacctgaaatcaactgtt
gatctgctaacaagtatcaccttttttaggatgaaggttttggagctgcagagcccccca
aaagccagcatggtggtgaaggactgtgtcagggcctgcctggattctacgtacaagtat
atttttgacaattgctatgaactctattcccagctgatagatccgagtaagaaacaggac
attcctcgggaagatcagggaccaaccaccaagaatttggatttttggccccaacttatt
acactgatggtcactattattgatgaggataaaactgcctacactcctgtcctgaatcag
tttcctcaagaactgaacatgggaaaaataagcgctgaaattatgtggaccctttttgct
caggatatgaaatatgcactagaagaacatgaaaagcagcggttatgcaagagcaccgat
tatatgaatttgcatttcaaagtgaaatggttttataatgaatatgtgcgagaacttcct
gccttcaaggatgccgttcctgaatactccttgtggtttgaaccttttgtcctgcagtgg
ctagatgagaatgaagatgtgtcaatggagttccttcatggagccctgggaagagacaaa
aaagatggattccagcagacgtctgatcatgcactcttttcttgctctgtggttgatgtc
tttgctcagcttaatcagagctttgagattattaagaaactggaatgccccaatcctgaa
gcattatctcacttaatgagaagatttgcaaagaccatcaataaagttctgcttcagtat
gctgcaattgtatcaagtgatttcagttcatattgtgataaggaaaatgtaccctgtata
ttgatgaacaatattcagcagttgcgggttcagctggagaaaatgtttgaatccatggga
ggaaaagaggtgg

DBGET integrated database retrieval system