KEGG   Sus scrofa (pig): 100516296Help
Entry
100516296         CDS       T01009                                 

Gene name
EGR3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
ssc  Sus scrofa (pig)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100516296 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    100516296 (EGR3)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100516296 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 349 aa AA seqDB search
MEPCAAWSPRGGRENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWC
QDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGEVEAMYPALPPYSNCSDLYSEPV
SFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPI
RVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACP
AEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFC
GRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAAPVSLAPVVTTCA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagccatgtgcggcgtggagtccccgcggtgggagagagaatgtgatggacatcggt
ctgaccaacgagaagcccaacccggaactctcttattcgggctccttccagccagccccc
ggcaacaagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgc
caggacaacatcattagcctcatgagcgccggcatattgggggtgcccccggcctcaggg
gcgctcagcacgcagacctctacggccagcatggtgcagccgcctcagggcgaagtggag
gccatgtatccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtg
tctttccacgacccccaaggcaaccctgggctggcctattccccgcaggattaccaatcg
gccaaaccggccttggacagcaatctcttccccatgattcctgactacaacctataccac
caccccaacgacatgggctccattccggagcacaagcctttccagggcatggaccccatc
cgggtcaacccgccccctattacccccttggagaccatcaaggcattcaaagacaagcag
atccacccgggctttggcagcctgccccagccgccgctcacgctcaagcctatccggccc
cgcaagtaccccaaccgacccagcaagaccccgctccacgagaggccccacgcgtgcccg
gcggagggctgcgaccgccgtttcagccgctcggacgagctgacccggcacctgcgcatc
cacacgggccacaagccctttcagtgtcggatctgcatgcggagcttcagccgcagcgac
caccttaccactcacatccgcacgcatacgggcgagaagccctttgcctgcgagttctgt
gggcgcaagtttgcgcgcagcgacgagcgcaaacgccacgccaagatccacctcaagcaa
aaggagaagaaggcagagaaggggggtgcgccttctgcgtcctcggcggccccggtatcc
ctggctcctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system