KEGG   Sus scrofa (pig): 100516440Help
Entry
100516440         CDS       T01009                                 

Gene name
B4GALNT1
Definition
beta-1,4-N-acetyl-galactosaminyl transferase 1
Orthology
K00725  
(N-Acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase [EC:2.4.1.92]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100516440 (B4GALNT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.92  (N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase
     100516440 (B4GALNT1)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  Glycolipid
   100516440 (B4GALNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 643 aa AA seqDB search
SQGAGGSEGRGNGSDWDLGQTDEVPGFGXEGVERRIFAPRRAGFAPPQGMALPSAAHSGP
GDARTEGLGCRASGVRGKRDAGEGEKKGGRETRGPGSASLGLLYASTRVAPGLQAPLAPW
TPLQGNPRPELPGLAPEPRYAHIPVRIKEQVVGLLSSNNCSCESSGGSLHFPFQRQVRQV
RAIDFTKAFDPEELRVASASREQEFQAFLSRSQSAADQLLIAXXXXXXXXPLQGVEVQPL
RSILVPGLSLQATSSQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQPDLTLASPGLDQLN
RXXXXXXXXXRSYLANTADTGARPGYRXXQAGRTQGTQKGRSGQRAEGVGDTRAMARAAQ
PHNGHFSWASRAKGREEAFVHLELEQARGKPEXWVCPPFRLYPPGPLPQGAQYNISALVT
IATKTFLRYNRLRALIASIRRFYPTVTVVIADDSDKPERISGPHIEHYLMPFGKGWFAGR
NLXXXXXXXKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGKGPRDVGWEKASGGLRP
RRGDPTESSEPWDGRERRIGFDPRLSRVAHLEFFLDGLGSLQVGSCSDVVVDHASKLKLP
WTSRDAGAETYARYRYPGSLDETQVAKHRLLFFKHRLQCMTSE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
tctcaaggagcgggcggctcggaaggaagagggaatgggagtgactgggatttggggcag
acggatgaggtgccagggttcggaanggagggcgtggagagaagaatcttcgcgccgcgc
cgcgccggcttcgcgcccccgcaaggtatggcgctgccctctgcagcccactcggggcca
ggtgatgctcgaactgaagggttgggatgccgggcctcaggcgtgagaggaaagcgagat
gcgggagagggcgagaagaaaggaggccgggagacccgaggcccggggagcgcctcgctg
gggctcctgtatgcgagcacccgggtcgcgccgggcctccaggcacctcttgcgccgtgg
acgcccctgcagggcaaccccaggccagaactaccaggtcttgcccccgagccccggtac
gcacatatcccggtcaggatcaaggagcaagtggtggggctgctatcttcaaataactgc
agttgtgagtccagtggggggagccttcacttccccttccagaggcaggttcggcaggtt
cgagccattgacttcaccaaggcctttgaccctgaggagctaagggttgcctctgcctca
agggaacaggagttccaggccttcctttcaaggagccagtctgctgctgaccagctgctc
atagcnnnnnnnnnnnnnnnnnnnnnnnnccccctgcagggtgtggaggtccagcccctc
aggagcatcttggtgccagggctaagcctgcaggccacttccagtcaggaggtctatcag
gtgaatctcactgcctccttgggcacctgggacgtggcaggggaagtgacaggagtgact
ctcactggagaggggcagccggatctcaccctcgccagcccagggctggaccaactcaat
cgnnnnnnnnnnnnnnnnnnnnnnnnnnnncgaagctacctggcaaacacagcagacaca
ggtgcgaggcctgggtacaggtagtaacaggctgggagaacacagggaacccagaaaggc
aggagtggacaaagggcagagggtgtgggagacactagggcaatggccagagctgcccag
ccacacaatgggcatttcagctgggccagcagggccaaggggagagaagaggcctttgtt
catctggagctggaacaggccagagggaaacctgagncttgggtatgtccccccttcagg
ctgtacccacctgggcctctaccccagggagcccagtacaacatcagcgctctggtcacc
atagccactaagaccttccttcgttacaatcggctacgggcactcatcgccagcattcgc
cgcttctacccgacggtcacagtggtcatcgccgatgacagcgacaagccagagcgcatt
agcggcccccacatcgagcactatctcatgccttttggcaagggctggttcgccggccgg
aacctnnnnnnnnnnnnnnnnnnnnccaagtacgtgctgtgggtggacgacgacttcgtc
tttacggcgcgtacgcgcctagagaggcttgtggacgtgctggagcggacgccgctggac
ctggtagggaaggggccgcgggatgtgggatgggagaaggcctcgggcgggctaaggccg
cggcgtggagacccgaccgagagcagcgagccctgggatgggagagaacgacgaatcggc
tttgacccgcgcctcagccgcgtagcgcacttggaattcttcctggatggacttggttct
cttcaggtgggctcctgctcagatgtcgttgtggatcatgcctccaagctgaagttgcct
tggacatcaagggatgctggggcagagacttatgcccggtaccgttacccgggatcattg
gacgaaactcaggtggccaaacaccgcctgctcttcttcaaacaccggctccagtgcatg
acctcggagtga

DBGET integrated database retrieval system