KEGG   Sus scrofa (pig): 100516483Help
Entry
100516483         CDS       T01009                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
ssc  Sus scrofa (pig)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ssc04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ssc04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:ssc04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 479 aa AA seqDB search
MANVTPVNGSAGNQSVRLVTATHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYVHISLASRSRVHKHRPEGPKEKKAKP
LAFLKSPLMKQSVKKPPPGEAAARGELRNGKLEEAPPPVLPPPPRPVADKDTSNESSSGS
ATQNTKERPPTELSTTEATTPAAPAPPLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtcacacccgtcaacggcagcgcgggcaaccagtctgtgcgcctggtcacg
gcgacccacaaccgctacgagacggtggagatggtgttcatcgccacggtgacgggctcc
ctgagcctggtgactgtcgtgggcaacatcctggtgatgctgtccatcaaagtcaacagg
cagctgcagacggtcaacaactacttcctcttcagcctggcgtgcgccgacctcatcatc
ggcgctttctccatgaacctctacaccgtgtacatcatcaagggctactggcctctgggc
gccgtggtctgtgacctctggctggccctggactacgtggtgagcaacgcctccgtcatg
aacctgctcatcatcagctttgaccgctacttctgcgtcaccaagccgctcacctacccg
gcccgccgcaccaccaagatggccggcctcatgatcgccgccgcctgggtcctgtccttc
gtgctctgggccccggccatcttgttctggcagtttgtggtgggcaagcggacggtgccg
gacaaccagtgcttcatccagttcctgtccaacccggcggtgaccttcggcacggccatc
gccgccttctacctgcccgtggtcatcatgacggtgctctacgtccacatctccctggcc
agtcgcagccgcgtccacaagcaccggcccgaaggcccgaaggagaagaaggccaagccc
ctggccttcctcaagagccccctgatgaagcagagcgtcaagaagccacccccgggagag
gccgccgcccggggggagctgcgcaacgggaagctggaggaggcccccccgccggtcctg
ccgcccccgccgcgccccgtggccgacaaggacacctccaatgagtccagctcgggcagt
gccacccagaacaccaaggagcgcccacccacggagctgtcgaccacagaggccaccacg
ccggcggcgccggcgcctcccctacagccacggaccctcaatccggcctccaagtggtcc
aagatccagatcgtgacgaagcagacgggcaatgagtgtgtgacggccatcgagattgtg
cctgccacgccggctggcatgcgtccggcggccaatgtggcccgcaagtttgccagcatc
gcccgcaaccaggtgcgcaaaaagcggcagatggcagcccgggagcgcaaggtgactcgg
accatctttgccatcctgctggccttcatcctcacctggacgccctacaacgtcatggtc
ctggtgaacaccttctgccagagctgcatccctgacaccgtgtggtccattggctactgg
ctctgctacgtcaacagcaccatcaacccggcctgctacgccctctgcaacgccaccttt
aaaaagacctttaggcacctgctgctgtgccagtatcggaacattggcactgccaggtag

DBGET integrated database retrieval system