KEGG   Sus scrofa (pig): 100516546Help
Entry
100516546         CDS       T01009                                 

Gene name
GNB2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04371  Apelin signaling pathway
ssc04713  Circadian entrainment
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04926  Relaxin signaling pathway
ssc05032  Morphine addiction
ssc05034  Alcoholism
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100516546 (GNB2)
   04371 Apelin signaling pathway
    100516546 (GNB2)
   04151 PI3K-Akt signaling pathway
    100516546 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100516546 (GNB2)
  Endocrine system
   04926 Relaxin signaling pathway
    100516546 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    100516546 (GNB2)
   04727 GABAergic synapse
    100516546 (GNB2)
   04725 Cholinergic synapse
    100516546 (GNB2)
   04728 Dopaminergic synapse
    100516546 (GNB2)
   04726 Serotonergic synapse
    100516546 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100516546 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    100516546 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100516546 (GNB2)
  Substance dependence
   05032 Morphine addiction
    100516546 (GNB2)
   05034 Alcoholism
    100516546 (GNB2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100516546 (GNB2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100516546 (GNB2)
GTP-binding proteins [BR:ssc04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100516546 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 100516546
NCBI-ProteinID: XP_003481037
Ensembl: ENSSSCG00000007669 ENSSSCG00000021890
UniProt: F2Z4Z8
Position
3
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggagattcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacacggaggactctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atttgggacagctacaccaccaacaaggtccacgctatcccactgcgctcctcttgggtc
atgacctgtgcctacgcgccctcagggaactttgtggcctgtgggggattggacaacatc
tgctccatctacagcctcaagacccgtgagggcaatgtcagggtcagccgggagctgcct
ggccacactggctacctgtcatgctgccgcttcctggatgacaaccaaatcatcaccagc
tcgggggacaccacctgtgccctgtgggacattgagactggccagcagacagtgggtttt
gctggacacagtggggatgtaatgtccctgtcgctggcccccgatggccgcacctttgtg
tcaggagcctgtgacgcctccatcaagctgtgggacgtgcgagattcgatgtgccgacag
accttcatcggccacgaatccgacatcaatgccgtggcattcttccccaacggctacgcc
ttcaccacgggctccgatgatgctacgtgccgcctctttgatctgcgggccgaccaggag
ctcctcatgtattcccacgacaacatcatctgcggcatcacctctgttgccttctcgcgc
agcggcaggctgctgctcgctggctatgatgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggtgtcctcgcaggccatgacaaccgtgtgagctgccttggtgtc
actgatgatggcatggctgtggccacaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system