KEGG   Sus scrofa (pig): 100516581Help
Entry
100516581         CDS       T01009                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04062  Chemokine signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04371  Apelin signaling pathway
ssc04540  Gap junction
ssc04611  Platelet activation
ssc04621  NOD-like receptor signaling pathway
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04728  Dopaminergic synapse
ssc04730  Long-term depression
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04924  Renin secretion
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04927  Cortisol synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04934  Cushing's syndrome
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc05010  Alzheimer's disease
ssc05016  Huntington's disease
ssc05142  Chagas disease (American trypanosomiasis)
ssc05143  African trypanosomiasis
ssc05146  Amoebiasis
ssc05200  Pathways in cancer
Module
ssc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100516581 (PLCB4)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100516581 (PLCB4)
   04310 Wnt signaling pathway
    100516581 (PLCB4)
   04371 Apelin signaling pathway
    100516581 (PLCB4)
   04020 Calcium signaling pathway
    100516581 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100516581 (PLCB4)
   04072 Phospholipase D signaling pathway
    100516581 (PLCB4)
   04071 Sphingolipid signaling pathway
    100516581 (PLCB4)
   04022 cGMP - PKG signaling pathway
    100516581 (PLCB4)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100516581 (PLCB4)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100516581 (PLCB4)
   04621 NOD-like receptor signaling pathway
    100516581 (PLCB4)
   04062 Chemokine signaling pathway
    100516581 (PLCB4)
  Endocrine system
   04911 Insulin secretion
    100516581 (PLCB4)
   04922 Glucagon signaling pathway
    100516581 (PLCB4)
   04912 GnRH signaling pathway
    100516581 (PLCB4)
   04915 Estrogen signaling pathway
    100516581 (PLCB4)
   04921 Oxytocin signaling pathway
    100516581 (PLCB4)
   04926 Relaxin signaling pathway
    100516581 (PLCB4)
   04918 Thyroid hormone synthesis
    100516581 (PLCB4)
   04919 Thyroid hormone signaling pathway
    100516581 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    100516581 (PLCB4)
   04916 Melanogenesis
    100516581 (PLCB4)
   04924 Renin secretion
    100516581 (PLCB4)
   04925 Aldosterone synthesis and secretion
    100516581 (PLCB4)
   04927 Cortisol synthesis and secretion
    100516581 (PLCB4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100516581 (PLCB4)
   04270 Vascular smooth muscle contraction
    100516581 (PLCB4)
  Digestive system
   04970 Salivary secretion
    100516581 (PLCB4)
   04971 Gastric acid secretion
    100516581 (PLCB4)
   04972 Pancreatic secretion
    100516581 (PLCB4)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100516581 (PLCB4)
  Nervous system
   04724 Glutamatergic synapse
    100516581 (PLCB4)
   04725 Cholinergic synapse
    100516581 (PLCB4)
   04728 Dopaminergic synapse
    100516581 (PLCB4)
   04726 Serotonergic synapse
    100516581 (PLCB4)
   04720 Long-term potentiation
    100516581 (PLCB4)
   04730 Long-term depression
    100516581 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    100516581 (PLCB4)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100516581 (PLCB4)
  Environmental adaptation
   04713 Circadian entrainment
    100516581 (PLCB4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100516581 (PLCB4)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100516581 (PLCB4)
   05016 Huntington's disease
    100516581 (PLCB4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100516581 (PLCB4)
   04934 Cushing's syndrome
    100516581 (PLCB4)
  Infectious diseases
   05146 Amoebiasis
    100516581 (PLCB4)
   05142 Chagas disease (American trypanosomiasis)
    100516581 (PLCB4)
   05143 African trypanosomiasis
    100516581 (PLCB4)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100516581 (PLCB4)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100516581 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100516581 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 100516581
NCBI-ProteinID: XP_013840518
Ensembl: ENSSSCG00000007058 ENSSSCG00000024199
UniProt: A0A287BD89
Position
17
AA seq 1206 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSVRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVNILEDDNEEEIESAEQEEEAHPEYKYGNELSVDDLGHKEAIANSVKKASD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALGAGLEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELSSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSDMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSCV
KLQDAN
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttccttcttgcaagaagga
gcagtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggacgaatttggcttctttctgacctggagaagtgaaggcaaggaaggacaagtacta
gaatgttccctcatcaacagtgtgcgtctgggagccacaccaaaggatcccaaaattttg
gctgctcttgaagctgttgggaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggtacagatctggtgaacatcagtttcacgtacatggtggctgaaaacccagaa
gtaactaagcaatgggttgaaggcctgcggtccatcattcacaacttcagggctaacaat
gtcagtccgatgacgtgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatgggaaaattccagttaggagtattactagaacctttgcatcggggaaaacggaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttacgagaagttctatgagctgacacaaaagatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagaccctcgattgaatgaaattttattt
ccattctatgatgctaaaagggcaatgcagatcattgaaatgtatgagcctgatgaagat
ctgaagaaaaaaggcctcatatcaagtgatgggttttgcagatacctgatgtcagatgaa
aatgcccccgtcttcctagatcggctcgagctttaccaagaaatggaccaccctctggct
cactacttcatcagctcttcccacaacacctatctcactggcaggcagtttggtggaaag
tcttcggtagaaatgtacaggcaggtcctcctggctggttgcagatgtgttgaacttgac
tgttgggatggaaaaggtgaggaccaagaaccaataataactcatggaaaagcaatgtgc
acagacattcttttcaaggatgttattcaagccatcaaggaaacggcatttgtcacatcg
gaataccctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctattcggagatctcctgttgaaacaagcacttgaatctcat
ccactggaaccaggcaggccgttgccatccccgaatgacctcaaaagaaaaatactcatc
aaaaataaacggctgaaacctgaggtggaaaaaaaacagcttgaagctttgaaaagcatg
atggaagcaggagaatctgctgcccctgtgaatatcctagaggatgacaacgaagaagaa
atcgaaagcgcggagcaagaggaagaagctcaccctgagtacaaatacggaaacgaactt
tctgtggacgacttgggtcacaaggaagctattgccaatagtgtcaagaaggcttcagat
gaccttgaacatgaaaacaacaaaaagggcctggttactgtagaagatgagcaggcgtgg
atggcatcttataaatatgtaggtgctaccactaacatccatccgtatctgtccacaatg
atcaactatgcacagcccgtcaagtttcaaggtttccatgtggctgaagaacgcaatatt
cattataacatgtcttcttttaacgagtcggtcggtctaggctacttgaaaacgcacgca
attgaattcgtgaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtcgattccagtaattacatgcctcagattttctggaacgctggttgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcaggggaaatttgagtataat
ggatcgtgcggataccttctcaagccagatttcatgagacggcccgatcgaacatttgat
cccttctctgaaacgcctgttgatggggttattgcagccacttgttcagtgcaggtcata
tcaggtcagttcttatcagataagaaaattggcacctatgtggaagtggatatgtatggg
ctgcccaccgacactatacggaaggaattccgaactcgcatggtgatgaacaacggactc
aatccagtttacaatgaagaatcatttgtgtttcggaaggtgatcctccctgacctggcg
gtcttgagaattgcagtgtatgatgacaacaacaggctgattggccagaggattctgccc
ctggatggccttcaggcaggctatcgacatatctcccttcgaaatgagggaaataaacct
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtagatgctttatcagatccaaagaaatttctttccattacggaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgatatcgctgatgtgcccagtgac
acgtcgaagaatgacaagaaagggaaagccaacacggccaaagccaacgtaacccctcag
agcagctctgagctcaggccgaccaccacggccgccctgggggctggcctggaggctaaa
aaaggtattgaactgatccctcaagtgaggatagaagatttaaagcaaatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagcttagttctttaaaaaagaaacatgcaaag
gagcacagtaccatgcagaagttacattgcacccaagttgacaaaatcgtggcacagtat
gacaaagagaagtcgactcatgagaagatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaattaaaattcagacgctgacatcagat
cacaaatctaaggtcaaggagattgtggcccagcacacaaaggagtggtcggacatgatc
aacacccacagtgcagaggagcaggagatccgggacctgcacctcagccagcagtgcgag
ctgctcagaaagctcctgatcaacgcccatgaacagcagacccagcagctgaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagagcgggaaaggcgagtcaga
gaattaaacagcagcaacactaaaaagtttctggaagagagaaagagacttgcaatgaag
cagtccaaagaaatggatcagttgaaaaaagtacagcttgagcacctcgaattcctagag
aaacagaatgagcagcttttgaaatcctgtcacgcagtgtcccaaactcaaggcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacagttgtgtg
aaactccaggacgcaaactga

DBGET integrated database retrieval system