KEGG   Sus scrofa (pig): 100516821Help
Entry
100516821         CDS       T01009                                 

Gene name
HDAC9
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
ssc  Sus scrofa (pig)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100516821 (HDAC9)
  Substance dependence
   05034 Alcoholism
    100516821 (HDAC9)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100516821 (HDAC9)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100516821 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 576 aa AA seqDB search
MLQTIYETDSCFPSDGVAGREQLLAQQRMHSMISSVDVKSEVPVGLEPISPLDLRTDLRM
MMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKLQQE
LLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQE
FLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDA
KDDFPLRKTESSVSSSSPGSGPSSPNNGPAGNVTENETSVLPPTPHAEKMVSQQRILIHE
DSMNLLSLYTSPSLPNITLGLPAVPAQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIP
ASSSHPHVTLEGKPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGI
RGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIEQ
LKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACADDSLGQVGAVKVKEEPVDS
DEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacaatttacgagactgactcgtgttttccttcagatggggtggctggacga
gagcagctcttggctcagcagagaatgcacagtatgatcagctcagtggatgtgaagtca
gaggttcctgtgggcctggagcccatctcgcctttagacctaaggacagacctcaggatg
atgatgcctgtggtggaccctgttgtccgtgagaagcaactgcagcaggagttattgctc
attcagcaacagcagcaaatccagaagcagctcttgattgcagagtttcagaaacagcat
gagaacttgacacggcagcatcaggctcaacttcaggagcacatcaagttgcaacaggaa
cttctagccataaaacagcaacaagaactcctagaaaaggagcagaaactggagcagcag
aggcaagaacaggaagtagagaggcatcgcagagaacagcagcttcctcctctcagaggc
aaagatagaggacgagaaagggcagtggcaagtacagaagtaaagcagaagcttcaagaa
ttcctgttgagtaaatcagcaacaaaagacactccaactaatggaaaaaatcattccgtg
agccgccatcccaagctctggtacacggctgcccaccacacgtcattggatcaaagctct
ccacccctgagtggaacgtctccatcttacaaatacacattaccaggagctcaagatgca
aaagatgatttcccccttcgaaaaactgaatcctcggtcagtagcagctctccggggtct
ggtcccagttcaccaaacaatgggccagctggaaatgttactgaaaatgagacttcggtt
ttgcctcctactcctcatgctgagaaaatggtttctcagcaacgcattctaattcacgaa
gattccatgaacctgctaagtctttatacctctccctctttgcccaacattaccttggga
cttccagcagtgccagcccagctcaatgcttcaaattcactcaaagaaaaacagaagtgt
gagacccagacactcaggcaaggtgttcctctgcctgggcagtatgggggcagcatcccg
gcatcttccagccatccccatgtcactttggaggggaagcccaacagcagccaccaagct
ctcctgcagcatttattactgaaagaacagatgcgacagcaaaagcttcttgtggctggt
ggcgttcccttacatcctcagtctcccttggcaacaaaagagagaatttcacctggaatt
agaggtacccacaaattaccccgtcacagacccctgaatcgaacccagtctgcacctttg
cctcagagcacattggctcagctggtcattcagcagcaacaccagcaattcttggagaag
cagaagcaataccagcagcagatccacatgaacaaactgctttcgaaatctattgaacaa
ctgaagcaaccaggcagtcacctcgaggaagcagaggaagagcttcagggggaccaggcg
atgcaggaagacagagcgccctctagtggcaacagcactaggagtgacagcagtgcttgt
gcggatgactcactgggacaagttggggctgtgaaggtcaaggaggaaccagtggacagt
gatgaagatgctcagatccaggaaatggaatctggggagcaggctgcttttatgcaacag
gtaataggcaaagatttagctccaggatttgtaattaaagtcattatctga

DBGET integrated database retrieval system