KEGG   Sus scrofa (pig): 100516911Help
Entry
100516911         CDS       T01009                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100516911 (USP44)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100516911 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 709 aa AA seqDB search
MLTMDKCKHIGRLQLAHDHSILNPQKWHCVDCNTTESIWACLSCPHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYFCDDYVLNDNATGDLKLLRSTLSAIKSQSYHCTTRSGRVL
RSVGTSDDSDFLHDGAQSLLQNEDQMYTALWHRRRILMGKIFRTWFEQSPIGRKRQEDQF
QEKIAKREVKKRRQELEYQVEAELESMPPRKSLRLQGLAQSTTVEIVPVQVPLQTSASPV
KVVSTSEDVRLKKASDFSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFLK
LDLNRWLSVTANDKTRSSYKHLPVTDTVYQMNDCQEKETGSLHSRYPSLSLGLSGGASKS
RKMELIQPREPSSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQQD
AQEFLCELLDKIQHELETTGTRLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACD
NKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSK
RRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGHNNREKIGVHVGFEEILNMEPY
CCRESLKSLRPECFIYDLAAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMD
EVCKAQAYILFYTQRVAENGHSKLLPPELLSGSQHPSEEADTSSNEILS
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgatggataagtgcaaacacatcgggcggttgcagcttgctcacgaccattcc
atcctcaaccctcagaaatggcactgtgtggactgtaacacaacagagtccatctgggcg
tgccttagctgtccccatgttgcctgtggaagatacattgaagaacacgcactcaagcac
tttcaagaaagcagtcatcctgttgccctggaggtgaatgagatgtatgttttttgctac
ttttgtgatgattatgttcttaatgataatgcaactggagacctgaagttactgcgaagt
acgttaagtgcaatcaaaagtcagagttatcactgtactactcgaagtggaagggttttg
cggtctgtgggtacaagtgatgattcggatttcttacacgatggtgcccaatctctgctt
caaaatgaagatcaaatgtatactgctctttggcacaggaggaggatactaatgggtaaa
atctttcgaacttggtttgaacagtcacccattggaagaaaaaggcaagaagatcaattt
caggaaaaaatagcaaaaagagaagtgaagaaaagacggcaagaactggagtatcaagtt
gaagcagaactggaaagtatgcctccaagaaagagtttacgtttgcaaggtctagctcag
tccaccacagtcgaaatagttcctgttcaagtaccactacaaacctcagcatccccagtg
aaagtcgtatctacctcagaagatgtaagattaaaaaaagccagtgacttctccgttaaa
cgaaggcccatcgtaactcctggtgtaacaggattaagaaatttgggaaatacttgctat
atgaattctgtccttcaagtgttaagtcatttacttatttttcgacagtgttttttaaaa
cttgatttgaaccgatggctctctgtgacagctaatgataaaacaagatcatcttataag
catcttccagtcacagatacagtatatcaaatgaatgactgccaagaaaaagaaacgggc
tctcttcactccagatatccaagtttatccttaggactaagtggtggagcatcaaagagt
agaaagatggagcttattcaaccaagggagcctagttcacaatacatttctctctgtcat
gaactgcatactttgttccaagtcatgtggtctggaaagtgggccttggtctcaccattt
gctatgctacactcagtatggagactgattcctgcttttcgtggttatgctcaacaagat
gctcaggaatttctttgtgagcttttggataaaatacagcatgaactggagacaactggt
accaggttaccagcgcttattcccacttctcaaaggaaacttattaaacaggttctgaat
gttgtgaataacatttttcatggacagcttcttagtcaggttacatgtcttgcatgtgac
aacaaatcaaataccatagaacctttctgggacttgtcactggaatttccagaaagatac
cagtgcagtggaaaagatattgcctcccagccatgtctggttactgaaatgttggccaaa
ttcacagaaactgaagctttagaaggaaaaatctacgtatgtgaccaatgtaattcaaag
cgtagaaggttttcctcaaaaccagttgtactcacagaagctcagaaacagcttatgatt
tgccacctacctcaggttctcagactacatcttaaacgtttcaggtggtcaggacataat
aaccgagagaagattggtgttcatgttggctttgaagaaatcttaaacatggagccctat
tgctgcagggaatccctgaaatccctcagaccagaatgttttatctatgacttagctgct
gtagtaatgcaccatgggaaaggatttggctcaggacactacactgcctactgttataat
tctgaaggagggttctgggtacactgcaatgattccaagctaagcatgtgcactatggat
gaagtatgcaaggcccaagcttatatcttgttttatacccagcgagttgctgagaacgga
cattctaaactcttgcctccagaactcttgtctggaagccaacatcccagtgaagaagct
gatacctcttctaatgaaatccttagctga

DBGET integrated database retrieval system