KEGG   Sus scrofa (pig): 100516938Help
Entry
100516938         CDS       T01009                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ssc  Sus scrofa (pig)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssc00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 106 aa AA seqDB search
MNKLEERCGWLSAPQAHVSEKHETNKVIAFERAGLLFVFNFHPSKSYTDYRVGTTLPGKF
KIVLDSDAAEYGGHQRLDHNTDFFSEPFEHNKRPYSLLVSKIFKIF
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattggaagaaagatgtggttggctttcagctccacaggcccatgtgagtgaa
aagcatgaaaccaataaggtcattgcttttgagagagcaggtcttctttttgttttcaat
tttcatccaagcaagagctacactgattaccgagttggaacgacattgccaggaaagttc
aaaattgtgctagattcagatgcagcagaatatggaggacaccagagactggaccacaat
accgacttcttctctgaaccttttgaacataataagcgtccctactctcttttggtaagt
aaaatttttaagatattttaa

DBGET integrated database retrieval system