KEGG   Sus scrofa (pig): 100517070Help
Entry
100517070         CDS       T01009                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100517070 (EIF3J)
Translation factors [BR:ssc03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100517070 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 261 aa AA seqDB search
MAAAAAAAAAGDSDSWDADTFSVDDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDD
EKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADK
LRLKKLQEESDLELAKETFGVNNTIYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYA
SFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMK
DDLADYGGYDGGYVQDYEDFM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcagcagcggcgggggactccgattcttgggacgcagacacg
ttctccgtggatgacccagtgcggaaggtggggggcggcggcaccgccggcggggaccgc
tgggaaggcgaggacgaggacgaggacgtcaaggataactgggatgatgatgatgatgat
gaaaaaaaagaggaagcagaagtaaaaccagaagtaaaaatttcagaaaagaaaaaaata
gcagagaagataaaagagaaagaacggcaacagaagaaaaggcaagaagaaattaaaaag
aggttagaagagcctgaagaacctaaagtgctaactccagaagaacaactagcagataaa
ctacggctaaagaaactacaggaagagtcagacctcgaattagcaaaagaaacttttggt
gttaataatacaatttatggaatagatgccatgaacccatcttcaagagatgacttcaca
gagtttggaaagttgctaaaagataaaattacacaatatgaaaagtcattatattatgcc
agttttttggaagccttagttcgagatgtgtgtatttcattggaaattgatgacttgaaa
aagattaccaattcattgactgtactctgcagtgaaaaacagaaacaagaaaagcaaagc
aaagccaaaaagaagaagaaaggtgtggttcctggagggggattaaaggccaccatgaaa
gatgatctcgcagattatggtggttatgatggaggatatgtacaagactatgaagacttc
atgtga

DBGET integrated database retrieval system