KEGG   Sus scrofa (pig): 100517121Help
Entry
100517121         CDS       T01009                                 

Definition
AP-1 complex subunit beta-1-like
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
ssc  Sus scrofa (pig)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100517121
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100517121
  Nervous system
   04721 Synaptic vesicle cycle
    100517121
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100517121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 819 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPNDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQV
NT seq 2459 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataaaaaaggagaaatctttgaattaaaggct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgactgtggggaaggatgttagctctctgtttccagatgtagtgaattgtatgcagact
gacaacctggaactaaagaagcttgtgtatctctatttgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggactgtgaagatcccaatcct
ctgattcgggccttggcagtcagaaccatggggtgtatccgggtggacaagattacggaa
tatctctgtgaacccctccgcaagtgcttaaaggatgaagatccctatgttcggaagaca
gcagcagtctgtgtggcaaaactccatgacatcaatgcccagatggttgaagatcaggga
tttctggattctctgcgggacctcatagcagattcaaatccaatggtggtggctaatgct
gtagcagcattatctgaaatcagtgaatctcacccaaacagcaacttacttgatctgaat
ccacagaacatcaataagctccttacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgaccgggaggcacagagcatc
tgtgagcgggtaactccccggctatctcatgccaactcagccgtggtgctttcagcggta
aaagtcctaatgaaatttcttgagttgttacccaatgactctgactactacaatatgctg
ctgaagaagttggcccctccacttgtcactttgctgtctggggagccagaggtgcagtac
gttgccctgaggaacatcaacctaattgtccaaaaaaggcctgaaatcttgaagcaggaa
atcaaagttttctttgtgaaatacaatgatcccatctatgtgaaactagagaaattggac
atcatgattcgcttggcatcccaagccaacattgctcaggttctagcagaactgaaggaa
tatgccacagaagtggatgtcgactttgtacgcaaagctgtacgagccattggacggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtaagcacattgctggatcttatccaa
accaaagtaaattatgtggtccaagaggcgattgttgtcatcagggacatcttccgcaaa
tatcccaacaagtacgaaagtatcatagctacactgtgtgagaacttagactcactggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaatcgac
aatgcagatgaattactagagagtttcctggaaggttttcatgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccttcagaaacacag
gagctggtacagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgtcacagccaaagaagtc
gtcttgtctgagaaaccactgatctctgaggagacagatcttattgagccaactctcttg
gatgagctcatctgtcacattggttctttggcctcagtgtaccataagcctcccaatgct
tttgtggaaggaagtcatggaatccatcgtaaacacttgccaatacatcatggaagcact
gacgcaggtgacagccctgttggcaccaccactgccaccaatctggaacagcctcaggtt
atcccctctcaaggtgaccttctgggggatcttttaaaccttgaccttggtcccccagtc
aatgtgccacaggtatcctccatgcagatgggagcagtcgatctcttgggaggaggactg
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacag
tccttcatcccatcatcagtgcctgccacctttgctccttcacctactcctgctgtggtc
agcagtggtctgaatgacttgtttgagctctccacggggataggcatggcgcctggtgga
tacgtggctcctaaggctgtctggctgcctgcagtaaaggctaaaggcttggagatttca
ggaacatttactcaccgccaagggcatatctatatggaaatgaacttcaccaacaaagct
ctgcagcacatgacggactttgcaattcagtttaacaagaatagttttggggtcatcccc
agcactcctctggccatccataccccactgatgccaaaccagagcattgatgtctccctg
cctctcaacactttgggcccagtcatgaagatggaacctctaaacaacctgcaggttag

DBGET integrated database retrieval system